KEGG   Glaesserella parasuis SH0165: HAPS_1747Help
Entry
HAPS_1747         CDS       T00825                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00010  Glycolysis / Gluconeogenesis
hap00051  Fructose and mannose metabolism
hap00562  Inositol phosphate metabolism
hap01100  Metabolic pathways
hap01110  Biosynthesis of secondary metabolites
hap01120  Microbial metabolism in diverse environments
hap01130  Biosynthesis of antibiotics
hap01200  Carbon metabolism
hap01230  Biosynthesis of amino acids
Module
hap_M00002  Glycolysis, core module involving three-carbon compounds
hap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAPS_1747 (tpiA)
   00051 Fructose and mannose metabolism
    HAPS_1747 (tpiA)
   00562 Inositol phosphate metabolism
    HAPS_1747 (tpiA)
Enzymes [BR:hap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HAPS_1747 (tpiA)
Exosome [BR:hap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HAPS_1747 (tpiA)
  Exosomal proteins of bladder cancer cells
   HAPS_1747 (tpiA)
  Exosomal proteins of melanoma cells
   HAPS_1747 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACL33264
UniProt: B8F7G2
Position
complement(1720591..1721382)
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELVESLKRELDGVTGCDVAIAPPVMYLAEAEAALASCGC
ECTTKKLIALGAQNVDVNVQGAFTGDISTAMLKDFGAKYIIIGHSERRTYHKESDEFIAK
KFAALKEAGLVPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAEAFNGAVIAYEPVWA
IGTGKSATPAQAQAVHAFIRGHIAKQSQAVADQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAEKAKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtccgttagtaatgggtaactggaaattaaacggtagcaaagcattcact
aaagaattagtggaaagcttaaaaagagaacttgatggtgttacaggttgtgatgtcgca
atcgcaccgccagtgatgtatttggcagaagcagaagcggcattggcgagctgtggttgt
gaatgcaccacgaagaaactcattgcattaggcgctcaaaacgttgatgtgaatgtacaa
ggtgcatttacaggtgatatttcaactgcaatgttaaaagatttcggtgcgaaatatatc
attatcggtcactctgagcgtcgtacttaccacaaagagagcgatgaatttattgcgaaa
aaatttgcagcattaaaagaagcaggtttagtgccagtgttatgtatcggtgaaactgaa
gcagaaaatgaagctggtcaaaccgaagcagtatgtgctcgtcaattagatgcagtatta
aatactttaggtgcagaagcattcaatggtgcagtaattgcgtacgaaccagtttgggca
atcggtacaggtaaatctgcaaccccagcacaggcgcaagcagttcacgctttcattcgt
ggtcacattgcaaaacagtcacaagcagtggcagatcaagtgatcattcaatacggcggt
tcagtcaatgatgcgaatgcagcagaattatttactcagccagacattgatggtgcgtta
gtgggcggtgcgtcacttaaagcgcctgcatttgcggtgatcgtaaaagcagcagaaaaa
gcgaaagcgtaa

DBGET integrated database retrieval system