KEGG   Glaesserella parasuis SH0165: HAPS_1992Help
Entry
HAPS_1992         CDS       T00825                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00260  Glycine, serine and threonine metabolism
hap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hap01100  Metabolic pathways
hap01110  Biosynthesis of secondary metabolites
hap01130  Biosynthesis of antibiotics
hap01230  Biosynthesis of amino acids
Module
hap_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAPS_1992 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HAPS_1992 (trpA)
Enzymes [BR:hap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HAPS_1992 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ACL33464
UniProt: B8F812
Position
complement(1954871..1955695)
Genome map
AA seq 274 aa AA seqDB search
MIVQSSRFSRLFAQLADKKQGGFVPFVTLCDPDFERSFEIICTLVDNGADALELGFPFSD
PLLDGPVIQAANDRALNAGCSTEESFQLLAKVRSTYPDIPISLLLCANLIYAQTLDKFYA
RCAEVGVDAVLVADIPLLAAEEYIQAAQRHDVQPVFICPPNANESTIKAVAQHTRGYTYL
VSRAGVTSAENQTQAANLDVLIEGLTQYQSAPILQGFGIAKPEQVKEALRLGAAGAISGS
ATVQIIERNLDNHPQCLLELAQFVQNMKRATHLS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgcaatcatctcgtttcagccgtttatttgctcaattagctgataaaaaacaa
gggggatttgttccttttgtgacactttgtgaccctgattttgagcgctcttttgagatt
atttgtactttagttgataatggtgcggatgccttagaattaggctttcccttttctgat
cccttgttggacggaccggttattcaggctgccaatgatcgggctctcaatgcaggttgt
agcaccgaagaaagttttcagttacttgccaaagtgcggtcaacctatccagacataccg
attagtctgttgctttgtgccaatttaatttatgcgcaaactcttgataaattctatgca
cgctgtgccgaagtgggcgttgatgccgtattggttgcagatattcctttactcgccgca
gaagaatatatccaagctgctcaacgtcatgatgtacagccggttttcatttgtccacct
aatgctaatgaatccacaattaaagcggtagctcaacatactcgaggttatacttattta
gtctcaagagccggcgttactagcgcagaaaatcaaacacaagctgccaatttagatgtt
cttattgaagggttaacccaatatcaaagcgccccaattttacaaggttttggtatcgca
aaaccggaacaagttaaagaggcgctgcgtttaggggctgccggtgcaatctcgggttcc
gctacagttcagattattgaacgaaacctcgacaatcaccctcaatgtttgcttgaattg
gcacaattcgtacaaaacatgaagagggcaacacatctctcataa

DBGET integrated database retrieval system