KEGG   Glaesserella parasuis SH0165: HAPS_2048Help
Entry
HAPS_2048         CDS       T00825                                 

Gene name
dfp
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00770  Pantothenate and CoA biosynthesis
hap01100  Metabolic pathways
Module
hap_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HAPS_2048 (dfp)
Enzymes [BR:hap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     HAPS_2048 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     HAPS_2048 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PEP_hydrolase 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACL33508
UniProt: B8F856
Position
complement(2007844..2008935)
Genome map
AA seq 363 aa AA seqDB search
MTPAAEAFVTPLTLQAISGNAVSTSLLDPQAELAMGHIELAKWADLVAIAPATADFIARL
RIGMGNDLLSTICLATASPILLAPAMNQQMYKRSIVQENLQSLTEQGVSIIGPNAGFQAC
GDIGKGRMSEPSEIFQAIEDHFTQSQDLADLSVVITAGPTREAIDPVRYISNHSSGKMGF
AIAEAFAKRGAKVTLIAGPVNLATPQNVSRIDVISAQQMAEQAVNLVQKNAIFIGCAAVA
DYRVEQVAEQKIKKTGDNDELTLKLVKNPDIIATVAHLTQNRPFVVGFAAETQNVADYAK
DKLQRKNLDLICANDVSGGQVFGQDQNTLHLFWQNGEKILPLAEKGKLAEKLVDEIVEHY
RHL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacccctgcggcagaagcctttgtcacaccgctgacattacaagccatttcaggtaat
gcggtttcaacctctttactcgatccccaagcggaattagcgatggggcatattgaattg
gcgaaatgggctgatttagtggcgattgctcctgcaacagctgattttattgctcgactg
cgtattggaatgggcaatgatttactttccacgatttgtttagcaacagcatctcctatt
ctgcttgcaccagcaatgaaccagcagatgtacaagcggtcgattgtgcaggaaaatttg
caaagtttgactgagcaaggtgtttcgatcattggacctaacgctggctttcaagcctgt
ggtgatataggcaaaggcagaatgtctgagccgagtgagatttttcaagcgattgaagat
cattttacgcaatcacaagatcttgctgatttgagcgtggtgattaccgcagggccaacg
cgtgaagcgatcgatcctgtgcgttatattagtaatcacagctcaggtaaaatgggcttt
gcgatagcggaagcctttgctaaacgtggggcaaaagttaccttgatcgcaggccctgtc
aatttggctacaccgcaaaatgttagccgtattgatgtgatttcggcacaacaaatggca
gaacaagcggtcaatttagtacagaaaaatgcgatttttatcggctgtgcggcggtggca
gattaccgagtggaacaggtagcagaacagaagattaagaaaactggtgataatgatgaa
cttactttaaaactggtgaaaaatcccgatattattgcaacagtagcccatcttactcaa
aatcgccctttcgtggtgggatttgctgcggaaacgcaaaatgtggctgattatgcgaaa
gataagctacaacgtaaaaatttggatttaatctgtgccaatgatgtgtctggcgggcag
gtgttcgggcaagatcaaaatacacttcatctcttttggcaaaatggcgagaagatctta
ccgcttgcagagaaagggaaattggcggaaaagctggtggatgagattgtagaacattac
cgccatctctaa

DBGET integrated database retrieval system