KEGG   Glaesserella parasuis SH0165: HAPS_2081Help
Entry
HAPS_2081         CDS       T00825                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00260  Glycine, serine and threonine metabolism
hap00750  Vitamin B6 metabolism
hap01100  Metabolic pathways
hap01110  Biosynthesis of secondary metabolites
hap01120  Microbial metabolism in diverse environments
hap01230  Biosynthesis of amino acids
Module
hap_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAPS_2081 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HAPS_2081 (thrC)
Enzymes [BR:hap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HAPS_2081 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACL33538
UniProt: B8F886
Position
complement(2041403..2042677)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQGVRQGLGKDQGLFFPEVLPKFDDIDALLALPLVERSQKILSAL
IGDELPQETLNAMVKNAFTFPAPLAKVNNDIYALELFHGPTLAFKDFGGRFMAQALSAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
ESDFDACQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEKRSDVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLKSGKWEPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWSLSELGSDALNDAETEEALKAQYAEGYLCEPHGAIAYQVLK
DQLQVGETGIFLCTAHPAKFKESVERILDIELPLPEALDKHNKMELLSDTMAADFAKLRE
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacctatacaacatcaaacaccctgaagaacaagtgaattttgcccaaggcgttcgc
caagggttaggcaaagatcagggcttatttttccctgaagtgttacctaaatttgacgac
attgacgctttattagcattaccgttggttgagcgtagccaaaagattttatcagcattg
attggcgatgaattaccacaagaaaccttaaatgcaatggtgaaaaatgcgtttactttc
cctgcaccactagcaaaagtgaataatgatatttatgcgttagagttattccacggtccg
acccttgcctttaaagactttggcggtcgctttatggcacaagcgttaagtgcggtgcgt
ggcgatggcaaaattacgattttaacagcaacatcaggtgacacaggtgcggcagtggct
cacgctttctacggtttagaaaatatcaatgtggttattctttatccgaaaggtaaaatc
agtccattacaagaaaaattattctgtaccttaggcggtaacattcgtaccgtggcgatt
gaatctgactttgatgcttgccaagcgttagttaaacaagcctttgatgatgcggaactt
cgtcaagctatcggcttaaactcagcaaactctatcaatatcagtcgtttactcgctcaa
gtttgttactactttgaagcggtggctcaattgccgaaagagaaacgtagcgatgtggtg
gtttctgtaccaagcggtaactttggtaacttaactgcaggcttaattgccaaaacctta
ggcttaccgattaagcgttttatcgcttcaaccaatgcgaacgacaccgtgccacgttat
cttaaatcgggcaaatgggaaccgaatgcaacggttgcgacattatcaaatgcaatggat
gttagccgtccgaacaactggccacgtgttgaagagctgtttaaacgtaatggttggagc
ttgagcgagttaggttcagatgccttaaatgatgcagaaaccgaagaagcattaaaagca
caatatgcggaaggctatttatgtgaaccgcacggggcaattgcttaccaagtattgaaa
gatcagctacaagtaggcgaaacaggtattttcctttgcaccgcacaccctgcgaaattt
aaagagagcgtagaacgtattttagatattgaactgccgttgcctgaagcgttagacaaa
cataacaaaatggaactgttgtcggatacaatggcggcagattttgcgaagttaagagag
tatcttttaaaatag

DBGET integrated database retrieval system