KEGG   Haloplanus sp. CBA1112: DU484_02615Help
Entry
DU484_02615       CDS       T05557                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
haq  Haloplanus sp. CBA1112
Pathway
haq00670  One carbon pool by folate
haq00720  Carbon fixation pathways in prokaryotes
haq01100  Metabolic pathways
haq01120  Microbial metabolism in diverse environments
haq01200  Carbon metabolism
Module
haq_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:haq00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DU484_02615
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DU484_02615
Enzymes [BR:haq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     DU484_02615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CPSase_L_D2 T2SSE
Motif
Other DBs
NCBI-ProteinID: AXG08844
UniProt: A0A345E9H2
Position
342431..344146
Genome map
AA seq 571 aa AA seqDB search
MASDDTDGEDAPTDMEIARAAETRPIEDVAGDLGLGPEDLDPQGNGIAKIEQDAIQRTLT
DAEEGNLILVTGTTATPKGAGKTVTTVGLGQGLNHLGERGVVAVREPSLGPVFGIKGGAA
GGGYSQVLPMEDINLHFTGDLHALTTAHNLVSATLDTKIHYGNELDVDVDEVSWKRALDM
NDRALREVVVGLGGSTNGPPREDGFQITAASEVMAVLCLADSLADLKERLSRTIVAYDST
GDPVTVSDLGIEGAMAMLLKDALRPNLVQTIEGSPAFVHGGPFANIAHGTNSLVADKLGL
ALGDYLVTEAGFAADLGFEKFGNIVSRHGVAPDAVVLTTAVRSMKYHGLEMWPVDYDELK
EPNPEAVSDGMVNLDHHAGIVERFDVPFVVAINRFPTDTDAEIQAIVDHCEEQGYPVVVS
NAFADGGEGAAELAETAKDLADSDEGDFEPLYDLDASLEEKIRTVATDVYGAEGAHFTED
AQDDLERLEEQGYGDMPVCLSKTQHSTTDDPTRKGAPKDDWTLTVRECYPDAGAGFVVVL
TGDVLTMPGLPAEPAAEGMDVDADGNVSGLF
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggatgacactgacggcgaggacgcaccgacggacatggagatcgcgcgcgcg
gcggagacgcgccccatcgaggacgtagcgggtgatctcgggctcggtcccgaggaccta
gacccgcagggcaacggcatcgccaagatcgaacaggacgcgatccagcggacgctcacc
gacgccgaggaggggaacctcatcctcgtcacggggacgacggcgacgccgaagggcgca
gggaagacggtgacgaccgtcggcctcggccaggggctgaaccacctcggcgagcgcggc
gtggtcgcggtccgcgagccgtcgctcggtcccgtcttcggcatcaagggtggcgccgcg
ggcggtggctactcgcaggtgctcccgatggaggacatcaacctccacttcacgggcgac
ctccacgcgctgacgacggcgcacaacctcgtctcggccaccctcgacaccaagatccac
tacggcaacgaactcgacgtcgacgtcgacgaggtgagctggaagcgcgcgctcgacatg
aacgaccgggcgctccgggaggtcgtggtcggtctcggcggctcgaccaacggcccgccc
cgggaggacggcttccagatcacggccgcctcggaggtgatggcggtgctctgtctcgcg
gactcgctcgcggacctcaaggaacgactctcgcggaccatcgtcgcctacgactcgacg
ggcgaccccgtcactgtctcggacctcggcatcgagggcgcgatggcgatgctcctgaag
gacgccctgcggcccaacctggtccagaccatcgagggctcgcccgcgttcgtccacggc
ggtcccttcgccaacatcgcccacggcaccaactcgctggtggcggacaaactcggcctc
gcgctgggcgactacctcgtcaccgaggcgggcttcgccgccgacctcggcttcgagaag
ttcggcaacatcgtctcccgccacggcgtcgcgcccgacgcggtggtgctcacgaccgcc
gtccggtcgatgaagtaccacggcctggagatgtggccggtcgactacgacgaactgaag
gaaccgaaccccgaggccgtgagcgacggcatggtgaacctcgaccaccacgccggcatc
gtcgagcggttcgacgtgcccttcgtcgtcgccatcaaccgcttcccgacggacacggac
gcggagattcaggccatcgtcgaccactgcgaggaacagggctacccggtcgtcgtctcg
aacgccttcgccgacggcggggagggcgccgcggaactcgccgagacggcgaaggatctc
gccgacagcgacgagggcgacttcgaacccctctacgacctcgacgcgagcctggaggag
aagatccgaaccgtcgccacggacgtgtacggtgccgagggcgcccacttcaccgaggac
gctcaggacgacctggaacgactggaggaacagggctacggcgacatgccggtctgcctg
tcgaagacccagcactcgacgaccgacgatccgacgcggaagggcgcgccgaaagacgac
tggacgctcacggtgcgtgagtgttaccccgacgccggcgccggcttcgtcgtcgtcctg
acgggcgacgtgctcaccatgcccggcctccccgccgaacccgcggcggaggggatggac
gtggacgcggacggcaacgtcagcggtctcttctaa

DBGET integrated database retrieval system