KEGG   Haloplanus sp. CBA1112: DU484_09610Help
Entry
DU484_09610       CDS       T05557                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
haq  Haloplanus sp. CBA1112
Pathway
haq00361  Chlorocyclohexane and chlorobenzene degradation
haq00625  Chloroalkane and chloroalkene degradation
haq01100  Metabolic pathways
haq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:haq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DU484_09610
   00361 Chlorocyclohexane and chlorobenzene degradation
    DU484_09610
Enzymes [BR:haq01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     DU484_09610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 HAD Hydrolase_like Hydrolase_6 NT5C
Motif
Other DBs
NCBI-ProteinID: AXG11809
UniProt: A0A345EHY7
Position
1699331..1700191
Genome map
AA seq 286 aa AA seqDB search
MMSSSSTCPYDAARESWATVRIPSMSAAVASRMSMVGSVRCRSLNGPGGDWHNYKRLSRV
PPCMAGLCFDMYGTLCDTSSVRTRLGEVLGVPDRLVAAVDETWRRKQLQYSYQSAQMDDY
EPFWAITSHALDYALAAYDLAPDAEARDRIRDAYNHLEPFPGAVEALTRLSEAGHDVVVL
SNGNPAMLERLADNAGLAPHLDDVLSADAVRTFKPDPAVYEHAAETLDRPIGDCRLISSN
AWDVAGAGNAGMATTWVNRARDPPEAIGARPDREVTTLPAVADDLC
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgtcctcaagtacgtgtccgtacgacgcggcgagggagtcgtgggccacggtc
cgaatcccgtcgatgtccgctgcggttgcctcgcggatgtccatggtggggagtgtgcgg
tgccgctccttaaatggtcccggtggggattggcacaactacaagaggctgtcacgtgtg
cccccgtgcatggccggactctgcttcgacatgtacgggacgctctgtgacacgagtagc
gtgcggacgcgcctcggcgaggtgctcggggtgcccgaccggctcgtcgccgccgtcgac
gagacgtggcgacgcaaacagctccagtactcctaccagagcgcacagatggacgactac
gaaccgttctgggccatcacgtcccacgcgctcgactacgcgctcgcggcgtacgacctc
gccccggacgccgaggcgcgtgaccgcatccgcgacgcgtacaaccatctggagccgttc
ccgggcgctgtcgaggcgctcacccgactctccgaggccggccacgacgtggtcgtcctc
tcgaacggcaaccccgccatgctcgaacgcctcgcggacaacgcggggctcgcgccccac
ctcgacgacgtgctgagcgcggacgcggtgcggacgttcaaacccgacccggcggtgtac
gaacacgccgcggagaccctcgaccgccccatcggcgactgccggttgatctcctcgaac
gcgtgggacgtcgccggcgccggcaacgcgggcatggcgacgacgtgggtgaaccgcgcg
cgtgacccgcccgaagccatcggtgcccgtccggaccgggaagtgacgaccctgccggcc
gtcgccgacgacctgtgctga

DBGET integrated database retrieval system