KEGG   Herminiimonas arsenicoxydans: HEAR0001
Entry
HEAR0001          CDS       T00490                                 

Gene name
dnaA
Definition
(GenBank) Chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
har  Herminiimonas arsenicoxydans
Pathway
har02020  Two-component system
Brite
KEGG Orthology (KO) [BR:har00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HEAR0001 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:har03032]
    HEAR0001 (dnaA)
   03036 Chromosome and associated proteins [BR:har03036]
    HEAR0001 (dnaA)
DNA replication proteins [BR:har03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    HEAR0001 (dnaA)
Chromosome and associated proteins [BR:har03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    HEAR0001 (dnaA)
SSDB
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AFP_2 ATPase_2 Arg_tRNA_synt_N AAA_16 AAA_14 XPB_DRD AFG1_ATPase TsaE RuvB_N
Other DBs
NCBI-ProteinID: CAL60241
UniProt: A4G154
Position
278..1660
AA seq 460 aa
MENFWQACSAQLEQELTPQQYSAWIKPLTPLDYEDGTLRIAAPNRFKLDWVKTQFASRIT
SIAAQFWEVPVEVQFVLDPRLVAARRPAAQASVVSDRADDVPSNVLEPIPSNATDHTPRR
DQSRINTALTFDSFVTGKANQLARAAAIQVANNPGSSYNPLFLYGGVGLGKTHLIHAIGN
QVLADNPNVKIRYIHAEQYVRDVVTAYQRKGFDDFKRYYHSLDLLLIDDIQFFGGKSRTQ
EEFFYAFEALIAAKKQIIITSDTYPKEITGMDDRLISRFDSGLTVAVEPPELEMRVAILL
KKAVQEGVTFSDDVAFFVAKHLRSNVRELEGALRKILAYSRFHGKDITIEVVKDALKDLL
SVQNRQISVENIQKTVADFFNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGE
LFGGRDHTTVLHAVRKIAADRGKSPECNHELHVLEQTLKG
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggaaaatttctggcaagcctgctccgctcaattggagcaggaattgacgccgcaacaa
tatagtgcgtggatcaagccgctcacgccgcttgattacgaggacggcaccttgcgcatt
gccgcgccgaatcgtttcaaactcgattgggtgaagacccagttcgccagccgcattacc
agcattgccgcgcagttttgggaagttccggtcgaggtgcagtttgtgctcgatccgcgt
ctggttgccgccagaaggccggcggcgcaagccagcgttgtatccgatcgggccgacgat
gtgccctccaatgtgctggaacctattccgtcgaatgcgaccgatcacacgccgcgccgc
gatcagagccgtattaatacagcgctgacatttgacagtttcgttaccggcaaggccaac
cagctggcgcgtgcggcggctatccaggtcgccaataatcccggcagttcgtacaacccg
ctgttcctgtatggcggcgtcggcctgggtaaaacccatttgatccatgccatcggcaat
caggtgctggcggacaatcccaacgtcaaaatacgctacatccatgcagaacagtacgtt
agagacgtagtgactgcttaccagcgcaagggtttcgacgatttcaagcgttattatcac
tcgcttgatttgttgctgatagacgacatccagttctttggcggcaagagccgcacgcag
gaagaattcttctatgcattcgaggcattgattgcagcaaagaaacaaatcatcatcacc
agcgatacctatccgaaagaaatcaccggtatggacgatcgcctgatttcacgtttcgac
tcgggtttgacggtcgccgtcgagccgccggaactggaaatgcgggttgccattctgctc
aaaaaagcggtgcaggaaggcgtgaccttctccgacgatgtggcgttttttgttgccaaa
catttacgttccaacgtgcgtgagctcgaaggcgcgttgcgcaagattcttgcctactcc
cgtttccacggcaaagacatcacgattgaagttgtaaaggatgcactgaaagatttgctg
tcggtgcagaatcgccagatctcggtcgaaaatatccagaaaaccgtggccgactttttc
aatataaaagttgccgatatgtattccaagaagcgtcctgcgaacatcgcgcggccacgc
cagattgcgatgtatcttgccaaggaattaacgcaaaaaagcctgccggaaatcggcgag
ctgttcggcggacgcgatcatacgaccgttttgcatgcggtgcgcaagattgccgccgat
agggggaagagcccggaatgcaatcatgaattgcatgtgctggagcaaactttgaagggc
tga

DBGET integrated database retrieval system