KEGG   Herminiimonas arsenicoxydans: HEAR0204Help
Entry
HEAR0204          CDS       T00490                                 

Gene name
apaG
Definition
(GenBank) Protein apaG
  KO
K06195  ApaG protein
Organism
har  Herminiimonas arsenicoxydans
Brite
KEGG Orthology (KO) [BR:har00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HEAR0204 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CAL60438
UniProt: A4G1Q1
Position
199695..200069
Genome map
AA seq 124 aa AA seqDB search
MASYEFTVTVNTQYLEEQSDPAHSNYVFAYAVTIKNTGQVAAQLISRHWVITDANNHIEE
VRGLGVVGNQPLLQPGEQFEYTSGTSMATPQGSMAGEYFCVAEDGEQFEAKIPEFVLSLP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctacgaatttaccgtgaccgtcaatacacagtacctggaagagcaatccgat
ccggcgcactccaattatgtattcgcgtacgcagtcaccatcaagaataccgggcaggta
gcggcgcaacttatttcgcgccattgggtcattaccgatgccaacaaccatattgaagag
gtgcgcggcctgggtgtagtcggcaatcagcctttgctgcagccgggcgaacagtttgaa
tacaccagcggcacctcgatggccacgccgcaaggctcgatggccggcgaatatttctgc
gtggcggaagatggcgagcaattcgaggcgaaaattcctgaattcgtcctgtccctgcca
cgcaccttgcattaa

DBGET integrated database retrieval system