KEGG   Herminiimonas arsenicoxydans: HEAR0216
Entry
HEAR0216          CDS       T00490                                 
Name
(GenBank) Putative gluconolactonase with senescence marker
Organism
har  Herminiimonas arsenicoxydans
SSDB
Motif
Pfam: SGL Arylesterase Phytase-like
Other DBs
NCBI-ProteinID: CAL60445
UniProt: A4G1Q8
Position
complement(211796..212686)
AA seq 296 aa
MSMENIQAILPTRMQLGECPLWHAQQAALYWIDIDGCAIHRFHPAHGAHHVWTMPSEPGC
IAINASGGLIVALRSGLALLDTDNGQLTTIAAAPYDPASTRFNDGRCDAAGRLWVGSIYE
PRDHPHAALYCIERGLIRDSGKRATVSNGVAFSPDNKTLYHADTTSHRISAYEYDVATGA
ISGTRLLKQFSTDKLNNYGGRPDGAAVDSEGAYWCAMYEGGKILRLSPDGEVLREIPLPV
RCPTMLAFGGDDLRTLYITTVSKNRPAAELKQFPLSGCVLSLRIDVAGLVEHAYLN
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtcgatggaaaacatacaagccattctgccaacacgcatgcagctgggcgaatgtccg
ctctggcatgcgcagcaggcagcactgtactggatagatatcgacggctgcgccatacat
cgcttccatccggcacatggcgcacaccatgtatggaccatgccgtccgaacccggctgc
attgcaatcaatgcaagcggtggtttgatcgtcgcactgcgttccggcctggcgctgctc
gataccgataacggccagctgacaactatcgctgcggcaccttacgatcctgcaagcacg
cgcttcaacgacggccgctgcgatgccgcaggccggctctgggtaggcagcatttacgaa
ccgcgcgaccatccgcatgcagcgctgtactgcatcgaacgcggcctcatacgcgatagc
ggcaaacgcgcgaccgtatctaacggcgttgccttcagcccggataacaaaacgctgtac
cacgccgataccacctcgcaccgcatcagcgcctacgaatacgatgttgctaccggcgcc
atctcaggtacgcgcctgctgaaacaattttccaccgataaattgaacaactacggcggc
cgtcctgatggcgcggccgtcgatagcgaaggcgcctactggtgtgccatgtatgaaggc
ggaaaaatcctgcgcctgtcgcctgacggcgaggtcttgcgtgaaatcccattgccggtg
cgctgcccgaccatgctcgctttcggcggcgacgatttgcgcaccctgtacatcacgacc
gtcagcaagaatcgccctgccgccgaactgaaacaatttcctctctctggttgcgtgttg
agcctgcgcattgatgtggccgggctggtcgaacatgcgtatctcaactga

DBGET integrated database retrieval system