KEGG   Herminiimonas arsenicoxydans: HEAR0561
Entry
HEAR0561          CDS       T00490                                 

Definition
(GenBank) conserved hypothetical protein
Organism
har  Herminiimonas arsenicoxydans
SSDB
Motif
Pfam: Transcrip_reg
Other DBs
NCBI-ProteinID: CAL60767
UniProt: A4G2N0
Position
complement(561826..562554)
AA seq 242 aa
MAGHSKWANIQHRKGRQDEKRGKIWTRLIKEITVAARMGGGDIAANPRLRLAVDKAADAN
MPKDNVTRAIQRGSGGLEGVNYEEIRYEGYGINGAAILVDCMTDNRVRTVAEVRHAFSKF
GGNMGTEGSVAFLFKHCGQFFFAPGTDEDKLMEAALEAGAEDVTTDEEGGIEVICPPHDF
SAVKDALAAAGFKAELAEVVMKPATETVFEGDDAVKMQKLLDALENLDDVQEVFTNAVIE
QA
NT seq 729 nt   +upstreamnt  +downstreamnt
atggcaggacatagcaaatgggccaatatccagcatcgtaaaggccgtcaagacgaaaaa
cgcggcaaaatctggacccggctgatcaaggaaatcactgtagcagcacgcatgggcggt
ggcgatatcgccgccaatccgcgcctgcgcctggcagtagacaaggcagccgatgccaat
atgccgaaagacaatgtcacacgcgcaatacaacgcggcagtggcggcctggaaggcgtt
aactacgaagaaatccgttacgaaggttatggcatcaacggtgcagcgattctggttgac
tgcatgacagacaatcgcgtgcgcacggtggcggaagtgcgccatgcattttccaagttt
ggcggcaatatgggcactgaaggttcggtcgcttttctgttcaagcattgcggccagttc
ttcttcgcacccggcaccgatgaagacaaactgatggaagcagcactcgaagcaggcgcc
gaagatgtgacgaccgacgaagaaggtgggatagaagtgatctgtccgccgcacgatttt
tccgccgtcaaggatgcactcgccgctgctggtttcaaagccgagctggcagaagtggtg
atgaagccggcgaccgaaacagtgttcgagggcgacgatgccgtcaagatgcagaaactg
ctcgatgccctggaaaatctcgacgatgtgcaagaagtgtttaccaacgcggtcatcgaa
caagcataa

DBGET integrated database retrieval system