KEGG   Herminiimonas arsenicoxydans: HEAR0577Help
Entry
HEAR0577          CDS       T00490                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00071  Fatty acid degradation
har00072  Synthesis and degradation of ketone bodies
har00280  Valine, leucine and isoleucine degradation
har00310  Lysine degradation
har00362  Benzoate degradation
har00380  Tryptophan metabolism
har00620  Pyruvate metabolism
har00630  Glyoxylate and dicarboxylate metabolism
har00640  Propanoate metabolism
har00650  Butanoate metabolism
har00900  Terpenoid backbone biosynthesis
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01130  Biosynthesis of antibiotics
har01200  Carbon metabolism
har01212  Fatty acid metabolism
har02020  Two-component system
Brite
KEGG Orthology (KO) [BR:har00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HEAR0577 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    HEAR0577 (phbA)
   00640 Propanoate metabolism
    HEAR0577 (phbA)
   00650 Butanoate metabolism
    HEAR0577 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HEAR0577 (phbA)
   00072 Synthesis and degradation of ketone bodies
    HEAR0577 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HEAR0577 (phbA)
   00310 Lysine degradation
    HEAR0577 (phbA)
   00380 Tryptophan metabolism
    HEAR0577 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HEAR0577 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HEAR0577 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HEAR0577 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:har04147]
    HEAR0577 (phbA)
Enzymes [BR:har01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HEAR0577 (phbA)
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HEAR0577 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAL60778
UniProt: A4G2P1
Position
580719..581894
Genome map
AA seq 391 aa AA seqDB search
MEEIVIVAAGRTAVGKFGGALAKIPAADLGAHIIRNLLLRTGIAADAISEVILGQVLTAG
CGQNPARQASIRGGLPDMVPAFTINKVCGSGLKATHLAAQAIQCGDAHIIIAGGQENMSA
SPHVLQNSREGIRMGDGKLVDTMIIDGLWDVYNQYHMGTTAENIAKKFGISRQEQDEFAL
ASQHKAEAAQNAGKFKDEIIPLEIPGKKGAVIVDSDEYIKPGTTLESLAALRPAFSKDGT
VTAGNASGINDGAAAVIMMTAKKAAELGLKPLARIKAYSSAGVDPAIMGMGPVPAAQLCL
KKAGWSHQDIDLMEINEAFAAQAIAVNREMGWDTGKINVNGGAIAIGHPIGASGCRILVT
LLHEMMRRDARRGLASLCIGGGMGVALAIER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaatcgttatagttgcagccggccgcactgcggtcggaaaattcggcggggca
ctggcaaaaatacctgctgcagatctgggcgcacatatcatcagaaatttattgttgcgc
acgggcatcgctgcggatgcgatcagtgaagtcatactcggccaggtgctgactgccgga
tgtgggcaaaatcctgcgcggcaggcatcgatacgcggcggcttgccggacatggtgccg
gcgttcaccatcaacaaagtgtgcggcagcggtttgaaggcgacacatcttgctgcgcaa
gccattcaatgcggcgatgcacacatcatcatcgcaggcggccaggaaaacatgagcgca
tcgccgcacgtattgcagaattcgcgcgaaggcatacgcatgggagatggaaaactggtc
gacaccatgatcatcgatggcctctgggatgtgtacaaccagtatcacatgggcacaacg
gcggaaaacattgcgaaaaaattcggcatatcacgccaggagcaggatgaattcgccttg
gcatcgcagcacaaggcagaagcagcgcagaatgcggggaaattcaaggatgagattatt
ccgcttgaaattccgggcaagaaaggcgccgtcatcgtcgattccgacgagtacatcaag
cccggcaccacgctggaatctctcgctgcattgcgtcctgctttttcaaaagacggcaca
gttacagcgggcaacgcatctggcatcaacgacggtgcggctgcagtgatcatgatgacg
gcgaagaaagcggctgaacttggactcaagccgttagcgcgcatcaaggcttattcttcc
gccggggtggatccagcaatcatgggtatggggccggtgccggcagctcagttatgcctg
aagaaagctggatggtcgcatcaggatattgatttgatggagatcaatgaagcttttgcc
gcgcaggcgattgcagtgaatcgggaaatgggctgggataccggcaagatcaatgtcaat
ggcggcgccatcgccatcggccatccgataggtgcatccggctgcaggatactggttacg
cttctgcatgaaatgatgcggcgcgatgcccgccgcggcctggcaagtctgtgcataggt
ggcggcatgggtgtggcactggcgatagagcgctag

DBGET integrated database retrieval system