KEGG   Herminiimonas arsenicoxydans: HEAR1223Help
Entry
HEAR1223          CDS       T00490                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00260  Glycine, serine and threonine metabolism
har00400  Phenylalanine, tyrosine and tryptophan biosynthesis
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01130  Biosynthesis of antibiotics
har01230  Biosynthesis of amino acids
Module
har_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HEAR1223 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HEAR1223 (trpB)
Enzymes [BR:har01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HEAR1223 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAL61399
UniProt: A4G4G2
Position
1242147..1243418
Genome map
AA seq 423 aa AA seqDB search
MKELDALGTYAERQAVSETALHQTAPYNLPDARGHFGQYGGSFVAETLSHALAELRDAYA
HYSKDPAFLAEFHYDLKHFVGRPSPIYHAKRWSEKMGGAQIYFKREDLNHTGAHKINNVI
GQALLARRMGKKRIIAETGAGQHGVATATICARFGLECVVYMGSEDVKRQAQNVYRMKLL
GATVVPVESGSKTLKDALNEAMRDWVTNIENTFYIIGTVAGPHPYPMMVRDFQSVIGNEC
LTQMPEMTSRQPDYVIACIGGGSNAMGIFYPYIEHKNVQLIGVEAAGEGLESGKHSASLM
AGSPGVLHGNRTYLLQDENGQIMETHSISAGLDYPGVGPEHAWLKDSGRAQYVSITDEDA
LQAFHDCCHIEGIIPALESSHALSYAAKLAATLPKEQVVLVNLSGRGDKDMHTVAQRMGL
QFD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagatgcgctcggtacatatgccgagcgacaggcagtgagcgaaaccgct
ttgcatcaaaccgcaccttacaatctgccggatgccagaggccacttcgggcaatatggc
ggcagttttgttgccgaaacgctgagtcatgcgctggccgaactgcgggacgcatatgcg
cactacagcaaggatccggctttcctcgcagaattccattacgacctcaagcatttcgtc
ggtcgccccagccctatctatcacgccaaacgctggtctgaaaaaatgggcggcgcgcag
atttatttcaagcgcgaagacttgaatcacactggtgcgcacaagatcaataatgtgatc
ggtcaggctctgctggctcgccgcatgggcaagaagcggatcatcgccgaaaccggtgcc
ggccagcacggcgttgccaccgcgactatctgcgcgcgcttcggccttgaatgcgtggtg
tacatggggagcgaagacgtcaagcgtcaggcgcaaaacgtgtaccggatgaagctgctc
ggtgccacggtggtgccggtcgagtccggctccaaaacactcaaggatgcgctgaatgaa
gccatgcgcgactgggttaccaacattgaaaacaccttttacatcataggcaccgttgcc
ggcccgcatccatatccgatgatggtgcgcgattttcaatcggtgataggaaatgaatgc
ctgacgcaaatgccggaaatgaccagccgtcaaccggattacgtgattgcctgcataggc
ggcggctcgaatgcgatgggaattttttatccttatatcgaacacaaaaatgtgcaactg
atcggtgtcgaagcagccggtgaaggactggaaagcggcaagcattcggcgtcgctgatg
gccggctcgcctggcgtgttgcacggtaaccgtacctatctgttgcaggatgagaatggc
cagatcatggaaacgcattccatctcggccggcctcgattatccaggtgtcgggcctgaa
catgcatggctgaaagactccggtcgtgcgcaatatgtgtctattaccgatgaagatgca
ttacaggcgtttcacgattgctgccatatcgagggcattattcccgcgctggaatcgagt
catgccttgagctatgcggccaagctggcagcaaccttgccgaaagaacaggtcgtgctg
gtcaatctttccggtcgtggcgacaaggatatgcatacggtggcgcagcgcatgggtttg
cagttcgactga

DBGET integrated database retrieval system