KEGG   Herminiimonas arsenicoxydans: HEAR1329Help
Entry
HEAR1329          CDS       T00490                                 

Gene name
galU
Definition
(GenBank) Glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00040  Pentose and glucuronate interconversions
har00052  Galactose metabolism
har00500  Starch and sucrose metabolism
har00520  Amino sugar and nucleotide sugar metabolism
har01100  Metabolic pathways
har01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HEAR1329 (galU)
   00052 Galactose metabolism
    HEAR1329 (galU)
   00500 Starch and sucrose metabolism
    HEAR1329 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HEAR1329 (galU)
Enzymes [BR:har01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HEAR1329 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CAL61502
UniProt: A4G4R5
Position
1348293..1349168
Genome map
AA seq 291 aa AA seqDB search
MNKIRKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIQYAVEEAVAAGITEMIFITGRN
KRAIEDHFDTAYELERELEAAGKTALLEFVQNVIPKHVNCIYIRQSAPLGLGHAVLCARP
VVGNEPFAVLLADDFMDTPAGTAPVLAQMVEIFEREGSSILAVQDVPRAETRQYGIVSAT
PYQDRLEQVDAIVEKPQPEDAPSTLAVVGRYILSGRIFDYLENVSQGAGGEIQLTDGIAA
LMRDQKVLAYRYEGQRYDCGSKLGYLKAMVDMGRKHPETGAAFTEYLKTLK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattagaaaagcagtgttcccggttgcaggcctgggcagccgtttcctgccc
gccaccaaggcgcaaccgaaagagatgctgccgatagtggacaagcccctgatccagtac
gcggtggaagaggcggttgcagccggcatcacggaaatgatcttcattaccggccgcaac
aagcgcgcaatagaagatcacttcgacaccgcatacgaactggaacgcgaactggaagcg
gcgggaaaaaccgcgctgctggagttcgtgcagaatgtgatccccaagcatgtgaattgc
atttacatccgtcaatctgccccgctgggtctgggccatgcagtgctgtgcgcgcgcccg
gtggtcggcaacgaaccgtttgcggtactgctggcggatgacttcatggatacgccggcc
ggcacggcgccggtactggcgcagatggttgaaatttttgaacgtgaaggcagcagcatc
cttgccgtgcaggacgtgccgcgcgcagaaaccaggcaatacggtatcgtcagcgcaacg
ccgtatcaggacaggctggagcaggtcgatgcgatcgtcgaaaagccgcagccggaagat
gcgccttcgacgctggcggtggtcgggcgttatatcctgagcggcaggatattcgattac
ctggaaaatgtgagtcagggcgcgggtggcgaaatacaattgaccgacggcattgcggcc
ctgatgcgcgatcaaaaggtgctggcttaccgttatgaaggtcagcgttatgattgtggt
tccaagctgggttatctgaaggcgatggtggacatggggcgcaagcatccggaaaccggc
gccgcctttacagaatatttgaagacactgaaatga

DBGET integrated database retrieval system