KEGG   Herminiimonas arsenicoxydans: HEAR1481Help
Entry
HEAR1481          CDS       T00490                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I (GTP-CH-I)
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00790  Folate biosynthesis
har01100  Metabolic pathways
Module
har_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HEAR1481 (folE)
Enzymes [BR:har01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HEAR1481 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CAL61652
UniProt: A4G565
Position
complement(1490087..1490692)
Genome map
AA seq 201 aa AA seqDB search
MSAHAGSAVVSEMEANDFSEHDWRRLLIHLGENPNRQGLQETPKRVQKAWQQWTAGYAQD
PAEILKVFSDGAEQYKELIIVRGIPVYSHCEHHLAPFFGTATIGYTPNGKIVGLSKLTRL
VDCYARRLQVQERLTIQIAETLMEHVQPLSVGVVIRCRHMCMESRGIQTQGEETVTSALL
GEMRSNPALRSEFLTLTREKD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacacgcaggcagcgcagttgtgagtgaaatggaagccaatgatttttcagag
catgactggcgtcggctgctgattcatctcggtgaaaatccgaatcgccagggcttgcag
gaaacgccgaaacgcgtgcagaaagcatggcagcaatggactgccggctatgcacaagat
ccggccgaaatcttgaaagtcttttcagacggtgccgaacagtacaaggagttgatcatc
gtgcggggtattcccgtgtacagccactgtgaacaccatcttgcgcccttcttcggtacc
gccaccataggctatacgccgaatggaaaaatcgtcggtctttccaagctgacgcgcctg
gtcgattgctacgcacggcgcttgcaggtgcaggaacgtctaaccatacagatagcagaa
acactgatggaacatgtgcaacccctgtcggttggcgtcgtcattcgatgccgtcacatg
tgcatggaaagtcgcggcatccagacgcagggcgaggagaccgtaacctcggcgctactg
ggtgaaatgcgcagcaatcctgcactcagaagcgaattcctgacgctgacgcgcgagaag
gattga

DBGET integrated database retrieval system