KEGG   Herminiimonas arsenicoxydans: HEAR1482Help
Entry
HEAR1482          CDS       T00490                                 

Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
har  Herminiimonas arsenicoxydans
Pathway
har02020  Two-component system
Brite
KEGG Orthology (KO) [BR:har00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HEAR1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CAL61653
UniProt: A4G566
Position
complement(1490731..1491141)
Genome map
AA seq 136 aa AA seqDB search
MRAFAGLILAACMASAATTASAAPDKGAALATQVKAGEAIYARCLACHALAYDRTGPRHC
GLFGRRAGSVKGFNYSDAMKHSNIVWNEKTLNLFLSNPTKTVPGTTMTYAGVTSQKERSD
LISYLKQANTSPECKK
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcatttgccggtttgattctggctgcctgcatggcatcggcagcaacaactgcc
agtgccgcacccgataagggtgcggcactggcgacgcaagtcaaggctggcgaagcgatt
tatgcgcgctgtctggcatgccatgcccttgcttacgatcgcaccggcccgcggcattgc
ggcttgttcggacgccgtgccggtagcgtgaagggtttcaattattcggatgcgatgaaa
cattcaaatatcgtctggaatgaaaagacgctgaatctgtttctcagcaacccgaccaaa
acggtgccgggaaccacgatgacgtatgccggagttacaagtcaaaaagaacgcagtgat
ctgatctcttacctgaaacaggccaacacatcgcctgaatgcaaaaaatga

DBGET integrated database retrieval system