KEGG   Herminiimonas arsenicoxydans: HEAR1543
Entry
HEAR1543          CDS       T00490                                 
Name
(GenBank) Hypothetical protein, putative phosphoesterase
Organism
har  Herminiimonas arsenicoxydans
SSDB
Motif
Pfam: DUF3703 PAP2 PAP2_3 PAP2_C
Other DBs
NCBI-ProteinID: CAL61708
UniProt: A4G5C1
Position
1534078..1535016
AA seq 312 aa
MTFKHILYDWDGLNVSLFQAINHSSGEFLSLLAYVGSIAGDYRSMPLLLCVLLLLAHRRA
QREDFLSAALLRLQARRFLVGFLIAWLSAGLLKVWLAFPRPLAVLGSSVQMIGSPHDLYS
FPSGHAVYAALVAVVLWRLVTSIFRPALLVFIVWVGWSRIAAGAHFPADVIAGSLIGAMS
GMLANRFVLPVLGDGNSTSIRRAFNRVLQQAKHLFSTGKLTRANTLLQDAHVLGQCLFWP
HFLSHLWMLRIAYVRRDWREMRGQLLRLALVPVGNVMGWLPLGNTGNTNVSVFKSMPTPI
RLKNIIEKQYDR
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaccttcaaacatattttgtacgattgggacggtttaaacgtctcgttgttccaggca
attaatcattccagcggagagtttttaagtctcttggcttatgtcggcagtatcgctggg
gactaccggagcatgccgcttttgctttgtgtgcttttgctcttggcacaccgccgtgcg
caacgcgaagactttctctcagcggcattgttgcgactgcaagccagacgttttcttgtt
ggcttcctgattgcgtggttgagcgcgggactgctgaaagtctggctcgcttttccgcga
cctttggcagtgcttggttcaagcgtacagatgatcgggtctccacatgatctttacagc
ttccccagtggtcacgcggtttatgcagcccttgtcgctgtagtgctttggcgtctcgtg
acatccatatttcgtcctgcactcttggtttttatcgtgtgggtggggtggtcaaggatc
gcggcaggcgcgcattttccagctgacgtgatagcgggtagtttgattggggctatgtca
ggaatgcttgcgaatcgatttgttctgccagtactaggggacggtaattcgacatctata
cgacgtgcatttaatcgagtattgcagcaagcgaagcacctgttttctactggaaaattg
acccgtgcgaacacgttattgcaggatgcgcacgtgcttggacagtgcctcttttggcca
cattttttgagccatctttggatgctgcgcatcgcatatgttcgacgagattggcgagaa
atgcgcggacaactactaaggcttgcgctggttccggtgggcaacgtcatgggatggcta
cctttaggtaatacaggaaacacgaacgtgagtgtattcaagtcgatgccaacaccaatt
cgtcttaaaaatattatagaaaaacaatatgaccgataa

DBGET integrated database retrieval system