KEGG   Herminiimonas arsenicoxydans: HEAR1771Help
Entry
HEAR1771          CDS       T00490                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00020  Citrate cycle (TCA cycle)
har00310  Lysine degradation
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01130  Biosynthesis of antibiotics
har01200  Carbon metabolism
Module
har_M00009  Citrate cycle (TCA cycle, Krebs cycle)
har_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HEAR1771 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HEAR1771 (sucB)
Enzymes [BR:har01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HEAR1771 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PMSI1
Motif
Other DBs
NCBI-ProteinID: CAL61927
UniProt: A4G5Z0
Position
complement(1781316..1782560)
Genome map
AA seq 414 aa AA seqDB search
MAILEITVPQLSESVAEATLLQWHKKVGETVARDENMIDIETDKVVLELPAPAAGVITQI
IRDDNSTVVAGEVIALLDTDLSAAVAPAASAPAAATAAPTAAPAMAASANAASNIAMPAA
AKMLAENQLAASDVAGTGKDGRVTKGDVINQLEKKQAAPVATAAKPALQQVTAPMSATML
ANRPEERVPMSRLRARIAERLLQSQSSNAILTTFNEVNMQPVMDLRAKYKDKFEKEHGVK
LGFMSFFVKAVVAALKKYPIINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRDADQMT
IAEIEKKIAEFGNKAKEGKLTLDDLNGGTFSISNGGVFGSMLSTPIINPPQSAILGIHAT
KERAVVENGQIVIRPMNYFAMSYDHRIIDGREAVLGLVAMKEAMEDPARLLLDL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggctattcttgagatcacagttccgcaattgtcggaatccgttgcagaagcaacgctg
ctgcaatggcataaaaaggtgggcgagaccgtcgcgcgcgacgaaaacatgatcgatatc
gaaaccgacaaggttgtgctggaattgccggcaccggccgccggcgtgatcacgcaaatc
attcgcgatgacaacagtaccgtggttgcgggtgaagttattgccttgctcgataccgat
ctgtcggctgcggttgcccctgcagcgtccgctcctgcagcagcaactgcggcgccaact
gctgcacctgcaatggcggcatccgcgaatgctgccagcaatattgcaatgccggccgca
gcaaaaatgctggcggagaaccagctggcagcgagcgatgttgccggcaccggcaaggat
ggccgtgtcaccaaaggcgatgtcatcaatcagctggagaaaaaacaggcagcgcctgta
gcgacagcagccaaacccgctctgcagcaagtgactgcgcccatgtcggccactatgctg
gccaatcgtccggaagagcgcgtgcccatgagccgcttgcgcgcccgtatcgccgagcgt
ttgctgcagtcgcaatcgagtaatgccatattgactacgttcaacgaagtcaatatgcag
ccggtgatggatctgcgtgccaagtacaaggacaagttcgaaaaagaacacggtgtcaaa
ctcggcttcatgtcatttttcgtcaaggcagtggttgctgcattgaaaaaatatccgatc
atcaatgcatcggtagacggtaatgacatcgtctatcacggctacttcgatatcggcatt
gccgtcggttcgccacgcggactggtggtgccgatcctgcgcgatgccgatcaaatgact
atcgctgaaattgaaaagaagattgcggaatttggcaacaaggccaaagaaggcaagctg
acgctggacgatctgaacggcggcactttctcgatttcaaacggcggcgtattcggttcg
atgctgtcgacgcctatcatcaacccaccgcaatcggcgattctggggatacatgcaacc
aaggagcgcgcagtggttgaaaacgggcagatcgtgatccgtccgatgaactacttcgcc
atgtcttacgatcatcgcatcatcgatggtcgcgaagccgtgctggggctggtggcgatg
aaggaagcgatggaagaccctgcgcgcctgttgctggacctttaa

DBGET integrated database retrieval system