KEGG   Herminiimonas arsenicoxydans: HEAR2003
Entry
HEAR2003          CDS       T00490                                 

Definition
(GenBank) Conserved hypothetical protein, putative lytic transglycolase
Organism
har  Herminiimonas arsenicoxydans
SSDB
Motif
Pfam: SLT Glucosaminidase SLT_3
Other DBs
NCBI-ProteinID: CAL62147
UniProt: A4G6L0
Position
2012181..2012771
AA seq 196 aa
MAAPALTARFRVLVIAAGLYACAVHAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRR
NGRIVPWPWSLNVAGQSRRYATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHKHRFTS
PCDLLDPYRNLAIASEILKEQHIPGENWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQG
TRPTAAVLAARQETTP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcagcgccagccctgacggcgcggtttcgcgtactggtgatcgctgctggcctgtac
gcctgcgccgtccatgcccaggaggttccgcctccggcctatcagcttgccgcccaacgt
gcgggcattccctccacggtgctctacgccgtggccttgcaggagagcggcatccggcgg
aacggacgcatcgtcccgtggccgtggtccctcaacgtcgccggccaatcgcgccgctat
gcgacccgcgccgacgcctgcgccggtttgcagcaggcgatgcgctccacgccgcacacg
cgcatcgacgcgggcctgggtcagatcaacctcggctaccacaagcaccgcttcaccagc
ccgtgcgacttgctcgatccgtaccgcaacctcgccatcgcctccgagatcctgaaggag
cagcacatcccgggggagaactggctgctggcgatcggccgctaccaccgccccgcgggg
ggcgagcccgcagcccgctaccggcggagcgtttcccgccacctcgcccgcgtgcagggc
acgcgcccaaccgccgcggtcctcgccgcgcgccaggagaccaccccatga

DBGET integrated database retrieval system