KEGG   Herminiimonas arsenicoxydans: HEAR2005
Entry
HEAR2005          CDS       T00490                                 
Name
(GenBank) Conserved hypothetical protein, putative ATPase domain
Organism
har  Herminiimonas arsenicoxydans
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Other DBs
NCBI-ProteinID: CAL62149
UniProt: A4G6L2
Position
2013321..2015507
AA seq 728 aa
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYR
DARVILCYRRNIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYV
EPTPAYRLARRLEERLEFAPFPLSRLSKLTGWDVPFNPVRPLPPVGGLPRLHGIEPDEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRRNAAGEHEVVIVIDPKGDADLLKR
MYVEAKRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREF
AWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKISQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPGASAGTRVPINVHADEFNELMGDEFVPLINKGGGAGLQVTAY
TQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGAT
DSSDIRGATDFTSNTQDRISMSSVPMIEPSHVVALPKGQCFALLQGGQLWKVRMPLPAPD
PDEVMPQDLQQLAGYMRQSYSEATQWWEFTSSPALQDGALPDDLLDDAAAAEPGPVATDD
SAGNEASP
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgtcggggaaacagccggtcgaggttctgcttcgcccagcggtggagctatataccgtc
gcggcgtgtgcaggcgccgcgtttctgtccctggtggccccgtggtcgctcgcgctgagc
cccgccatgggtgtcggcagcgcgctggcgttcggagcctatggcgcgatccgctaccgc
gatgcccgcgtcatcctgtgctaccggcgcaacatccgtcgcctgccgcgctacgtgatg
accagcaaggacgtgccggtcagccagcaacgtctgtttgtgggacgcggctttctgtgg
gagcagaaacacacccataggctcatgcagacgtaccggccagagtttcggcgctacgtc
gagccgacgccggcctatcggctggcccggcgcctggaggaacggctggagttcgcgccg
ttcccgctgtcccggctatcgaaactcaccggctgggacgtgcctttcaatccggtgcgg
ccgctgccgccagtgggcggcctgccgcgcctgcacggcatcgaacccgacgaggtggac
gtcagcctgccgctgggtgagcgcgtgggccactccttggttttgggaacgacaagggtg
ggcaaaacacgtttggccgaactcttcgtcactcaagacatccgccggaggaacgccgcg
ggcgaacacgaggtcgtgatcgtcatcgaccccaaaggagatgccgatctcctgaagcgg
atgtatgtcgaggccaagcgcgcgggccgcgaaggcgagttctatgtcttccatttgggg
tggccggacatttcggcacgctacaacgccgtaggccgattcggtcgcatctcggaagtc
gccacccgcatcgcggggcagctctccggcgaaggcaacagcgcagccttcagggaattc
gcgtggcgcttcgtcaacatcattgcccgcgccttggtggaactggggcagcgcccggac
tacatgctgatccagcggcacgtcatcaacatcgacgcgctgttcatcgagtacgcccag
cactacttcgccaagaccgagcccaaagcctgggaggtgatcgtccagatcgaggccaag
ctcaacgagaagaacatcccgcgcaacatgattgggcgcgagaagcgcgtggtggcgctg
gagcagtacctatcccaggcccgtaactacgacccggtgctcgacggcctgcgctcggcg
gttcgctacgacaagacgtatttcgacaagatcgtcgcgtctttgctgccgctgctggag
aagctcaccagcgggaagatttcccagcttctggcgccgaactattccgacctggccgac
ccccgcccgatcttcgattggatgcaggtcatccgaaagcgcgcagtcgtctatgtgggc
ctggacgcgctatccgatgccgaggtcgccgcagcggtcggcaactcgatgttcagcgat
ctcgtttcggtggcaggccatatctacaagcacgggatcgatgacggcctgccgggcgca
tcggctggcacgcgcgtgccgatcaacgtccacgcggatgaattcaatgaactgatgggt
gacgagttcgtgccgctgatcaacaaaggcggcggcgccggtctgcaggtcaccgcgtac
acgcagacgctttcggacatcgaggcccgtatcgggaaccgcgccaaagcgggtcaagtg
attggcaatttcaacaatctgttcatgctgagggtcagggagacggccaccgccgaactg
ctgacccggcaattgccgaaggtcgaggtctatacgaccaccatcgtctccggcgcgacc
gacagctcggacatccgcggcgcgacggacttcaccagcaacacgcaggaccgcatcagc
atgtccagcgtgccgatgatcgagccgtcgcacgtcgtcgccttacccaagggccaatgt
ttcgcattgttgcagggcggccagctttggaaggttcgcatgccgctgccggcaccggac
cccgatgaggtcatgccgcaggatctgcaacaactggcgggctacatgcgccagagctac
agcgaggccacgcagtggtgggagttcaccagttccccggcgttgcaggacggggccttg
cccgacgacctgttggatgatgccgctgcggccgaacctggcccggtggccaccgacgac
agcgccggcaatgaggcctcgccatga

DBGET integrated database retrieval system