KEGG   Herminiimonas arsenicoxydans: HEAR2015
Entry
HEAR2015          CDS       T00490                                 

Definition
(GenBank) Conserved hypothetical protein; putative membrane protein
Organism
har  Herminiimonas arsenicoxydans
SSDB
Motif
Pfam: DUF3487 TraL
Other DBs
NCBI-ProteinID: CAL62159
UniProt: A4G6M2
Position
2023029..2023439
AA seq 136 aa
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTI
ALAPTFVVLGVAFGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRYPLVAGWVGGHVLIS
RSGFWTTRRSAARGAR
NT seq 411 nt   +upstreamnt  +downstreamnt
atgtccgagcagcagcacgtccgtgctgacgggacggtcacgttccttccgcaccggctc
aaccgccatcccgttgtcgtgcgcggcctcaccgccgacgagctgtggatctgctgcggc
ctgtccggcgccgccggcctgctggtcggtgcgccgctgtcctgggtgttccgcacgatc
gcgctcgcgcccacgttcgtcgtgctgggcgtggccttcggcgtgttcatcgggggcggc
atcctgcgtcgcctcaagcgtgggcgtcccgacacctggctgtatcggcaactccagtgg
cgcatcgccacgcgctatccgctggtggcgggctgggtgggcggccatgtgctgatctca
cgctccggcttctggaccacccgaaggtctgctgcaaggggggcacgatga

DBGET integrated database retrieval system