KEGG   Herminiimonas arsenicoxydans: HEAR2018Help
Entry
HEAR2018          CDS       T00490                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
har  Herminiimonas arsenicoxydans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0242 Macoilin Pex19 Golgin_A5 FUSC
Motif
Other DBs
NCBI-ProteinID: CAL62162
UniProt: A4G6M5
Position
2025029..2026459
Genome map
AA seq 476 aa AA seqDB search
MRSNGLLKWLMIPVALLVLFVAIRLFSGGGSSAPPAADAGAKLTPEEMKALGIEGDTPRD
TVATLVAQVKQLRTELQTALSDNKSQREENQRLRQRENSIDQRINSALETERSNLRRDQQ
QAASERQQTEGLLADLQRRLEGIGGRGGGHADLPVGLGLRNGDEAGMEGGVRWVEPDDAK
PADGRNGSRGTGGGMSFPTSFGPAQSTLETTAQTVANAGARAAGVKSAKPVYTVPTNSTL
MGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLS
CVRGQVRSITFVFHDGTIRTIPEDRDGNQQNNQQQNSQSGGLGWISDPYGIPCVSGERRS
NAQQYLGSQALITAAGAGVASLIDSDSGQMSYVGADGSIGSVGISSNEAVGRILAGGVRD
MADWVNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtaacggactcctgaagtggttaatgatccccgtggccctgctggtgctgttc
gtcgccatccggctgttttcgggtggaggctcgtcggcgccgcccgctgcggatgccggc
gccaagctcacgccggaggagatgaaggcgctgggcatcgagggcgataccccccgcgat
accgtggcgacgctcgtggcgcaagtgaagcagttgcgcaccgaactgcagacggcgctg
tccgacaacaagtcccagcgcgaagagaaccagcgcctgcgccaacgcgagaactcgatc
gaccagcgcatcaattcggcgctggagaccgagcgctccaacctgcgccgcgaccagcag
caggcagccagcgaacgccagcagaccgagggactgctcgccgacctgcagcggcgcctg
gaaggcatcggcgggcgcggcggcggccacgccgatctacccgtgggcctggggctgcgt
aacggcgacgaggcaggcatggaaggcggcgtgcgctgggtcgagccggacgacgcgaag
cccgctgatgggcgtaacggcagtcgcggcacgggtggcggcatgagctttccgacgagc
ttcggccccgcgcagagcacgctggaaaccacggcacaaaccgtggcgaacgcgggcgcc
cgcgccgcaggcgtcaagagcgccaagccggtctatacggtgccgaccaactcgacgctg
atgggatcggtggcaatgacggcgctgatcggccgcgtgccgatcgacggtacggtcaac
gatccgtatccgttcaaagtcctggtcggtcccgacaatctcacggcaaacggtatcgac
attcccgacgtggcgggcgccgtgttttccggcacggcctcgggcgactggacgctctct
tgcgtgcgcggccaggtgcgcagcatcacctttgtgttccatgacgggaccattcggacg
attcccgaagaccgcgacggcaaccagcagaacaaccagcagcagaactctcaaagtggg
ggcctgggctggatcagcgatccctatggcattccctgcgtcagcggagagcggcgcagc
aacgcccagcagtacctcggttcgcaggcgctgatcaccgcggcgggtgctggcgtggcc
tcgctcatcgacagcgacagcggtcagatgtcctacgtgggcgcagacggttccatcggc
agcgtcggcatttccagcaacgaggccgtaggtcgcatcctggccggtggcgtgcgcgac
atggccgattgggtgaacaagttgtacggccaggccttcgccgccgtctatgtccaaccc
ggcgcaaaggtcgccgtccacctcgaaaagccgctcgccatcgatttcgatcccgaaggt
cgcaaggtcgatcaccgtgcaggagaaagccatgctctcgaacttgaataa

DBGET integrated database retrieval system