KEGG   Herminiimonas arsenicoxydans: HEAR2023Help
Entry
HEAR2023          CDS       T00490                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
har  Herminiimonas arsenicoxydans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1525 Thioredoxin_3
Motif
Other DBs
NCBI-ProteinID: CAL62167
UniProt: A4G6N0
Position
2031378..2031824
Genome map
AA seq 148 aa AA seqDB search
MPASFPRFAPSWRALGLAVALPVSLGVFSPATFAADVLVITDSRHPVKTMGGERLIELDE
AHRIEAELSAELPAEPEQATAIVKRRLNSGGTDLQRRIASAYQGVTDAWSLGITSIPAVV
VDQRYVVYGEPDVARAVARIEQHWRAQP
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccagcatcttttcccaggttcgcgccaagctggcgagcccttggcctggccgttgca
ctgccggtgtccttgggtgtctttagtccggccacattcgctgccgatgtgctggtcatc
accgacagccgccatccggtcaagaccatgggcggcgagcggctgatcgagctggacgaa
gcgcaccggatcgaagcggagctttctgcggaactgcccgccgaacccgagcaggcgacc
gccatcgtcaagcgccgactgaacagcggcggcaccgatctccaacgccgcatcgcttcc
gcctaccagggcgtcaccgacgcgtggagcctgggcatcaccagcatcccggccgtcgtg
gtggatcaacgctacgtcgtctatggcgaaccggatgtggcccgcgcagtcgctcgcatc
gagcagcactggagggcccagccgtga

DBGET integrated database retrieval system