KEGG   Herminiimonas arsenicoxydans: HEAR2131Help
Entry
HEAR2131          CDS       T00490                                 

Gene name
rpoZ
Definition
(GenBank) DNA-directed RNA polymerase omega chain (RNAP omega subunit) (Transcriptase omega chain) (RNA polymerase omega subunit)
  KO
K03060  DNA-directed RNA polymerase subunit omega [EC:2.7.7.6]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har03020  RNA polymerase
Module
har_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:har00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    HEAR2131 (rpoZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:har03021]
    HEAR2131 (rpoZ)
   03400 DNA repair and recombination proteins [BR:har03400]
    HEAR2131 (rpoZ)
Enzymes [BR:har01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     HEAR2131 (rpoZ)
Transcription machinery [BR:har03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     HEAR2131 (rpoZ)
DNA repair and recombination proteins [BR:har03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      HEAR2131 (rpoZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb6
Motif
Other DBs
NCBI-ProteinID: CAL62268
UniProt: A4G6Y1
Position
2130217..2130420
Genome map
AA seq 67 aa AA seqDB search
MARITIEDCLKQIPNRFQLTLCATYRARQLLQGHTPKVDAKDKPTVIALREIAAGHVGIE
MLKKVPS
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatcaccattgaggactgcctcaaacagattccaaaccgctttcaactgacc
ttgtgcgcaacttatcgcgcacgtcaattgctgcaaggccacacgcctaaggttgacgca
aaagacaagccaaccgtgatcgccctgcgtgaaatcgcagctggccacgtcggcattgaa
atgttgaaaaaagtcccaagctaa

DBGET integrated database retrieval system