KEGG   Herminiimonas arsenicoxydans: HEAR2149Help
Entry
HEAR2149          CDS       T00490                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00260  Glycine, serine and threonine metabolism
har00750  Vitamin B6 metabolism
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01230  Biosynthesis of amino acids
Module
har_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HEAR2149 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HEAR2149 (thrC)
Enzymes [BR:har01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HEAR2149 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CAL62286
UniProt: A4G6Z9
Position
complement(2151269..2152729)
Genome map
AA seq 486 aa AA seqDB search
MQYISTRGASAPQSFSHILLGGLAPDGGLYLPAEYPQVTGAELDVWRTLSYPDLAFEVLK
KFATDIPEADLHALVHKTYTADVYRNVRHGEEAARITPLRLVEEKDGSKLMLQALSNGPT
LAFKDMAMQLLGNLFEYTLAKQHAELNIFGATSGDTGSAAEYAMRGKKGIRVFMLSPHKK
MSAFQTAQMFSLQDPNIFNIAVDGVFDDCQDMVKAVSNDHAFKQQQKIGTVNSINWARVV
AQVIYYFRGYLSATTSNEQKVSFTVPSGNFGNICAGHIARMMGLPIHQLVAATNENDVLD
EFFRTGVYRVRKSAETYHTTSPSMDISKASNFERFVFDLLGRDGARVRALFQKVETHGGF
DLSGKPGSDGDEFKNIAQFGFVSGKSTHADRLATIRDLHAKYDLMIDTHTADGVKVAREH
LTPGITMIVLETALPAKFNETIREALGRDAERPAGFENIEDLPQRFEVMTKDIEKMKAFI
TAHTGL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatatctcgacccgcggtgcgtccgccccccagtctttttcccatatcctgctt
ggcggcctggcgcccgatggcggactgtatctgccggctgaatatccgcaagtgacgggt
gcagaactcgatgtgtggcgtacgttgtcctaccccgatctggcgtttgaagtgctgaaa
aaattcgctaccgatattccggaagcggatttgcatgcgctggtgcacaaaacctatacc
gcagacgtatatcgcaatgtgcgccacggcgaagaagctgcacgcattacgcctttgcgt
ctggtagaggaaaaagacggcagcaaactgatgctgcaggccttgtcgaatggcccgacg
ctggccttcaaggacatggcgatgcaattgctcggcaatctgttcgagtacacgctggcc
aaacaacatgcggaactgaatattttcggcgccacgtccggcgataccggcagcgcggca
gaatatgcgatgcgcggcaagaagggcatacgcgtcttcatgctgtcgccgcacaagaaa
atgagcgcctttcagactgcgcagatgttcagcctgcaggatccgaacattttcaatatt
gccgtcgacggcgtgttcgacgattgccaggatatggtcaaggccgtctccaacgatcat
gcgttcaagcagcagcagaaaatcggcaccgtcaattcgatcaactgggcgcgcgtggtg
gcgcaagtgatctactatttccgtggctacctgagcgccaccaccagcaatgaacagaag
gtatcgttcactgtgccatcgggtaatttcggcaatatctgcgccggtcacatcgcgcgc
atgatgggtttgcccattcaccaattggtggccgcgaccaacgagaacgatgtgctcgac
gagtttttccgcaccggcgtgtatcgcgtgcgcaaatcggctgaaacctatcacaccacc
agtccgagcatggatatcagcaaggcatcgaacttcgagcgtttcgtgttcgatttgctg
ggtcgcgatggcgcgcgcgtgcgcgccctgttccagaaagtggaaacgcacggcggattc
gacctgtccggcaagccgggcagcgatggcgacgagttcaagaacattgcgcagttcggt
tttgtttccggcaaatcgacgcatgcagaccgcctggccacgatacgcgacctgcacgcc
aagtacgatctgatgatagacacgcacactgcggatggcgtcaaggttgcgcgcgaacac
ctgacgccgggcatcacgatgatcgtgctggaaaccgccttgcctgccaaattcaatgaa
accatacgcgaagcgctgggccgcgatgccgaacgtccggccggtttcgaaaatatcgag
gatttgccgcagcgttttgaagtgatgacgaaggatatcgagaagatgaaagcgttcatc
accgcgcataccggtttgtaa

DBGET integrated database retrieval system