KEGG   Herminiimonas arsenicoxydans: HEAR2552
Entry
HEAR2552          CDS       T00490                                 

Gene name
groL
Definition
(GenBank) 60 kDa chaperonin (Protein Cpn60) (groEL protein)
  KO
K04077  chaperonin GroEL
Organism
har  Herminiimonas arsenicoxydans
Pathway
har03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:har00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HEAR2552 (groL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:har03019]
    HEAR2552 (groL)
   03110 Chaperones and folding catalysts [BR:har03110]
    HEAR2552 (groL)
   03029 Mitochondrial biogenesis [BR:har03029]
    HEAR2552 (groL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:har04147]
    HEAR2552 (groL)
Messenger RNA biogenesis [BR:har03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     HEAR2552 (groL)
Chaperones and folding catalysts [BR:har03110]
 Heat shock proteins
  HSP60 / Chaperonin
   HEAR2552 (groL)
Mitochondrial biogenesis [BR:har03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    HEAR2552 (groL)
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HEAR2552 (groL)
  Exosomal proteins of other body fluids (saliva and urine)
   HEAR2552 (groL)
  Exosomal proteins of breast cancer cells
   HEAR2552 (groL)
  Exosomal proteins of colorectal cancer cells
   HEAR2552 (groL)
  Exosomal proteins of bladder cancer cells
   HEAR2552 (groL)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-ProteinID: CAL62674
UniProt: A4G837
Position
2520465..2522105
AA seq 546 aa
MAAKEVIFGDAARAKMVEGVNVLANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEI
ELKDKLQNMGAQLVKEVASRTSDNAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGI
DKAVAATVEQLALIAKPCTTTKEIAQVGAISANSDYSIGERIAEAMEKVGKEGVITVEDG
KSLNDELDIVEGMQFDRGYLSPYFINNPEKQTAILENPFILLCDKKISNIRDLLPVLEQV
AKAGRPLLIIAEDIEGEALATLVVNNIRGILKTCAVKAPGFGDRRKAMLEDIAILSGGQV
VAEEVGLTLEKITLEELGQAKRIEIGKENTTLIDGNGQAINIEARVKQIRAQIEEATSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALL
RARANINVKGDNSDQEAGIRIVLRAMEEPLRMIVQNAGEEASVVVAKVLEGKGNFGYNAA
NGIYGDMVEMGVLDPAKVTRSALQNAASIAALLLTTDCMVAEVAEEKPAGGDMGGMGGMG
GMGGMM
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggcagctaaagaagttatattcggcgacgcagcgcgcgccaagatggtcgaaggcgtc
aacgtactggccaatgcagttaaagtaactctgggccctaaaggtcgtaacgtggtgctg
gaacgttcgttcggcgcacctaccgttaccaaggatggtgtttcggttgcgaaagaaatc
gaactcaaggacaaactgcaaaacatgggcgcgcagctcgtgaaagaagtggcttcccgc
accagcgacaacgcaggcgacggcaccaccactgcaaccgtattggcacaagcgatcgtt
cgcgaaggcatgaaatacgttgcagccggcatgaaccctatggatctgaaacgcggtatc
gacaaggctgttgcagcgactgtcgaacaactcgcgctgatcgcaaaaccatgcaccacg
accaaagaaatcgcccaggttggcgcgatctcggcgaactcggactactcgatcggcgag
cgtatcgctgaagcgatggaaaaagtcggcaaggaaggcgtcatcactgttgaagacggc
aaatccctgaacgacgaactcgatatcgttgaaggtatgcagttcgaccgcggctacctg
tcgccatacttcatcaacaacccggaaaagcaaaccgctattctggaaaacccgttcatc
ctgttgtgcgacaaaaaaatctccaatatccgtgacctgctcccggtactggaacaagtc
gctaaagccggtcgtccactgctgatcattgcagaagacatcgaaggcgaagcactggca
actctggttgtgaacaacatccgcggcatcctgaaaacctgtgctgttaaagcaccaggc
ttcggcgatcgtcgtaaagccatgctggaagacatcgctatcttgagcggcggccaagtc
gttgctgaagaagtcggtctgacactggaaaaaatcacgctggaagagttaggccaggct
aaacgtatcgaaatcggcaaggaaaacaccacgctgatcgacggtaacggccaagcgatc
aacatcgaagcacgcgttaaacaaatccgcgcgcaaatcgaagaagcaacatcggactac
gaccgcgaaaaactgcaggaacgcgttgccaaactggcaggcggcgttgcagtcatcaaa
gtcggtgcagctaccgaagttgaaatgaaagagaaaaaagcacgcgttgaagatgcattg
cacgctacccgcgctgcagtcgaagaaggcatcgttcctggcggcggcgttgcactgttg
cgcgcacgcgccaacatcaatgtcaaaggcgacaactcggatcaggaagccggtatccgt
atcgtgctgcgcgcaatggaagagccactgcgcatgatcgtgcaaaacgctggtgaagaa
gcatccgtcgttgtggctaaagtactcgaaggcaaaggtaacttcggttacaacgcagcc
aacggtatctacggcgacatggttgaaatgggtgttctcgatccagccaaagtgacccgt
tcggcattgcaaaatgctgcttcgatcgctgcactgttgttgaccaccgattgcatggtt
gccgaagttgctgaagaaaaaccagctggcggcgacatgggtggcatgggcggcatgggt
ggtatgggcggcatgatgtaa

DBGET integrated database retrieval system