KEGG   Herminiimonas arsenicoxydans: HEAR2750
Entry
HEAR2750          CDS       T00490                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT)
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00860  Porphyrin and chlorophyll metabolism
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
Module
har_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:har00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HEAR2750 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:har01007]
    HEAR2750 (hemL)
Enzymes [BR:har01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     HEAR2750 (hemL)
Amino acid related enzymes [BR:har01007]
 Aminotransferase (transaminase)
  Class III
   HEAR2750 (hemL)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: CAL62867
UniProt: A4G8N0
Position
2723269..2724555
AA seq 428 aa
MSSNNEILFARAQKSTPGGVNSPVRAFRSVGGTPRFITRAEGPYFWDADDRRYIDYIGSW
GPAIVGHAHPDVVKAVQDAATRGLSFGAPTEGEIRMAELICQLVPSIEQVRLVSSGTEAA
MSALRLARGATGRDTIIKFEGCYHGHADSLLVKAGSGLLTFGNPTSAGVPEDFAKHTLVL
DYNNPQQLEDTFKEIGNQIACVIVEPVAGNMNLLPATPEFLQTMRRVCTQYGAVLIFDEV
MSGFRVALGGAQSMYDIKPDLTVLGKVIGGGLPVAAFGGRTDLMQHLAPLGGVYQAGTLS
GNPVTVAAGLATLKLIQVPGFYESLATQTGKLVAGLSAAARAANIAFSANSVGGMFGMYF
AAEKPQSYTEMMKCDVAHFNTFFHAMLDAGVYLAPSAFEAGFVSAQHDDAIIEASIQAAR
QAFAQLGQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgtcatccaacaacgaaattcttttcgcccgcgcccaaaaaagtacgccgggcggcgtc
aattcgccagtccgcgccttccgttccgtcggtggtacgccgcgcttcattacccgcgct
gaaggcccttacttctgggatgccgacgacagacgctacattgattacatcggctcgtgg
ggcccagccattgtcggtcatgcgcacccggatgtcgtcaaggcggtacaagatgcggcg
acgcgcggcctgagcttcggcgcgccgaccgaaggcgaaatccggatggcggaattgatc
tgccaactggtgccatcgatcgaacaggtgcgtctggtttccagcggcaccgaagcggcg
atgagcgccctgcgcctggcacgcggagcaaccggtcgcgatacgatcatcaagtttgaa
ggttgttatcacggccatgccgattcgctgctggtaaaagccggcagcggcttgctgacc
ttcggcaatccgacttcagccggcgtgccggaagattttgccaagcacacgctggtgctg
gactataacaatccgcagcaactcgaagatacattcaaggaaatcggcaaccagattgcc
tgcgtgatcgtcgagccggttgccggcaacatgaatctgctgcctgccacgccggaattc
ctgcaaaccatgcgtcgcgtctgtacgcaatacggcgccgtgctgatattcgatgaagta
atgtccggcttccgcgtcgcgctcggcggggcgcaatcgatgtacgatatcaagcccgat
ctgacggtactgggaaaagtcatcggcggcggcttgccggtggccgcattcggcggacgc
acagatttgatgcagcatctggcgccactcggcggcgtgtatcaggcgggaacattgtcg
ggcaacccggtcaccgtcgcagccggcctggcaacgctgaagttgatccaggtgcccgga
ttctatgagtcgctggcgacacaaaccggcaaactggtcgcgggcttgagtgccgcggca
cgcgcagcgaatatcgccttcagcgccaattcggtcggcggcatgttcggcatgtacttc
gcggctgaaaaaccgcagtcgtatacagaaatgatgaaatgcgatgtcgcgcatttcaac
accttcttccatgccatgctggatgcaggagtttatctggcgccatcggcgtttgaagcc
ggcttcgtgtccgcacagcacgacgatgcaattatcgaggccagcattcaggctgcgcgt
caggcatttgcacaactgggtcaataa

DBGET integrated database retrieval system