KEGG   Herminiimonas arsenicoxydans: HEAR2784Help
Entry
HEAR2784          CDS       T00490                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase (Gamma-glutamyl kinase) (GK)
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00330  Arginine and proline metabolism
har00332  Carbapenem biosynthesis
har01100  Metabolic pathways
har01130  Biosynthesis of antibiotics
har01230  Biosynthesis of amino acids
Module
har_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HEAR2784 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HEAR2784 (proB)
Enzymes [BR:har01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HEAR2784 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA sCache_3_2
Motif
Other DBs
NCBI-ProteinID: CAL62900
UniProt: A4G8R3
Position
complement(2758049..2759167)
Genome map
AA seq 372 aa AA seqDB search
MDSAIQSAKRIIIKVGSSLVTNDGKGLDTAAIQKWAEQIVQLRALGKEVVLVSSGAIAEG
MQRLGFDKRPTGVHELQACAAVGQMGLAQIYETSFRQHQVQTAQILLTHADLADRERYLN
ARSTLFTLLQLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEADALIILTDQRGLFS
ADPRKDPHATFIHEAQAGDVELEAMAGGAGSSLGRGGMLTKILAAKRAALSGAHTVIAWG
REEQVLTRLAAGEAIGTQLTAQTAQLTARKQWMADHLHTAGRIVLDQGAVLKLTAEGKSL
LPIGVIEVSGSFGRGDVITCVDQSGRAIARGITNYTSSEARRIMRKPSTDILSILGFVEE
PELIHRDNLVLL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggattctgccattcaatcagccaaacgcatcatcatcaaggtcggctcttcgctcgtc
actaatgacggcaagggactcgatactgccgcgattcaaaaatgggcagagcagatcgtt
caattacgcgccttgggcaaggaagtggtactggtcagttcaggtgccattgccgaaggt
atgcagcgtctcggattcgacaagcgtccgactggcgtccacgagttgcaggcctgtgct
gcagtcggtcagatggggctggcgcaaatctatgaaaccagtttccgtcagcatcaggta
caaaccgcgcaaattctgctgacgcatgctgatctggcggatcgtgagcgttatctgaat
gcgcgatcgacattgtttacattgctgcagctgggagtagtacccatcatcaatgaaaac
gataccgtcgtcaccgatgaaatcaagttcggcgataacgatacgctgggtgcgctggta
gccaatctgatcgaagccgatgcgctgattattttgaccgatcaacgcggcctgttcagc
gccgatccgcgcaaagacccgcatgccacgttcattcatgaagcacaggctggcgatgtc
gagctggaagcgatggcaggcggtgcgggcagtagccttggtcgcggcggcatgctgaca
aaaatactggcggccaagcgggcggcattgtctggtgcacatacggtgattgcctgggga
cgcgaagaacaggtattgacgcgtttggcggctggcgaagcgataggcacgcaattgact
gcgcaaactgcgcaactgacggcgcgcaagcaatggatggcggatcatttgcacacggca
ggcaggatcgtgctcgatcagggcgccgtgctgaaattgacggcagaaggaaaatcgctg
ttgcctatcggcgtgatcgaggtgtccggcagtttcgggcgcggcgatgtgattacctgt
gtcgatcaatcaggccgggcaattgcacgcggcattaccaactacacaagttcggaggct
cgccgcatcatgcgcaagccgtcgacggacattttatccattcttggttttgttgaagag
ccggaattgatacaccgcgataatctggtgttgttgtaa

DBGET integrated database retrieval system