KEGG   Herminiimonas arsenicoxydans: HEAR2892Help
Entry
HEAR2892          CDS       T00490                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00900  Terpenoid backbone biosynthesis
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HEAR2892 (ispE)
Enzymes [BR:har01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HEAR2892 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAL63006
UniProt: A4G919
Position
2868052..2868912
Genome map
AA seq 286 aa AA seqDB search
MVRTLNNCPAPAKLNLFLHVTGRRADGYHLLQSVFQLIDRGDVLHFSVRDDGLIHRSTEL
AGVPADSDLVVRAARLLQTEAKKQGKTPGADIAIEKKLPMGGGLGGGSSDAATTLLALNH
LWQTGLTRAELMALGLQLGADVPFFLFGQNAFAEGIGEALMAVKTPESWFLVIEPGVSVP
TQQIFSSLELTRDTKPVKISDFSRAQESFGKNDLQVVAANLFPPIADAIKWLQQFGDARM
TGSGACVFCPFKEEQQVDAVLATVPQQWKAWKAKAITHHPLAYLAT
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcacactcaacaactgcccggcgccggccaagctgaatctttttttgcacgtc
accgggcgacgcgcagatggttaccacctgctacaaagcgtattccagctgatcgatcgc
ggcgatgtactgcatttttccgtacgcgacgatggcctcatccatcgcagcacggaattg
gcaggcgtgccggctgacagcgatctggtcgtgcgtgccgcgagactgttgcaaacggaa
gcaaaaaaacaaggcaagactcccggcgcggatatcgccatcgaaaaaaaactgcccatg
ggcggcggtctgggcggcggctcgtccgatgccgcgaccacgctgctcgccctcaaccat
ctttggcaaaccggattgacgcgcgccgaattaatggcgctcggactgcaactaggggcg
gacgtgccgttttttctattcggccagaatgcatttgccgagggcataggcgaggcttta
atggcggtaaaaacaccggaatcctggttcctggtgatcgaacccggcgtgtcggtaccg
acccagcagatattttcttcattggaattgacaagggatacgaaacccgtcaaaatatcg
gacttttccagagctcaagaaagcttcggtaaaaacgacctgcaagtcgtggctgcaaac
ttgtttccgccgatagccgacgccattaaatggctgcagcaattcggagatgcgagaatg
acggggtccggcgcttgtgtgttttgtccgtttaaggaagaacaacaagtcgatgcagta
ctggcaacggtaccgcagcaatggaaagcatggaaagccaaagcgatcacgcatcatccg
ctcgcttatttggcaacgtaa

DBGET integrated database retrieval system