KEGG   Herminiimonas arsenicoxydans: HEAR2900
Entry
HEAR2900          CDS       T00490                                 

Gene name
coaD
Definition
(GenBank) Phosphopantetheine adenylyltransferase (Pantetheine-phosphate adenylyltransferase) (PPAT) (Dephospho-CoA pyrophosphorylase)
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00770  Pantothenate and CoA biosynthesis
har01100  Metabolic pathways
Module
har_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:har00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HEAR2900 (coaD)
Enzymes [BR:har01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     HEAR2900 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: CAL63014
UniProt: A4G927
Position
complement(2875561..2876052)
AA seq 163 aa
MVTAIYPGTFDPLTRGHEDLVRRASGLFDKLIVGVADSKNKKPFFSLEERLTISNEVLGH
YPNVHVESFSGLLKDFVRRHDARVIVRGLRAVSDFEYEFQMAGMNRYLLPDVETLFLTPS
DQYQFISGTIVREIAALGGDVSKFVFPSVDKWLKEKIAAQEQG
NT seq 492 nt   +upstreamnt  +downstreamnt
atggtcacagctatctatccaggaacattcgatccacttacgcgtggccatgaagatctg
gtgcgtcgtgcatccggcctgttcgataaattgatcgtcggtgttgccgatagcaagaac
aaaaaaccattcttttcactggaagaacgtctgacgatttccaatgaagtactgggtcat
tatcctaacgtgcacgtcgaaagtttttccggcttgctgaaggatttcgtgcgtaggcac
gatgcgcgcgtgattgtgcgcggcctgcgtgcggtatccgattttgaatacgaattccag
atggccggcatgaaccgctatttgctgccggatgtggaaacgctgttcctgactccctcc
gatcagtatcagttcatctctggtacgatagtccgtgagattgccgcactgggcggcgat
gtatcgaagtttgtttttccttccgtcgacaaatggctgaaagaaaaaatcgctgcgcaa
gagcagggataa

DBGET integrated database retrieval system