KEGG   Herminiimonas arsenicoxydans: HEAR2975Help
Entry
HEAR2975          CDS       T00490                                 

Gene name
gpmA1
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) (dPGM)
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
har  Herminiimonas arsenicoxydans
Pathway
har00010  Glycolysis / Gluconeogenesis
har00260  Glycine, serine and threonine metabolism
har00680  Methane metabolism
har01100  Metabolic pathways
har01110  Biosynthesis of secondary metabolites
har01120  Microbial metabolism in diverse environments
har01130  Biosynthesis of antibiotics
har01200  Carbon metabolism
har01230  Biosynthesis of amino acids
Module
har_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:har00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HEAR2975 (gpmA1)
  Energy metabolism
   00680 Methane metabolism
    HEAR2975 (gpmA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HEAR2975 (gpmA1)
Enzymes [BR:har01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HEAR2975 (gpmA1)
Membrane trafficking [BR:har04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HEAR2975 (gpmA1)
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HEAR2975 (gpmA1)
  Exosomal proteins of melanoma cells
   HEAR2975 (gpmA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAL63085
UniProt: A4G998
Position
2940174..2940920
Genome map
AA seq 248 aa AA seqDB search
MYKIVLMRHGESTWNLDNRFTGWADVDLTEKGCAEAKHAGKLLRDAGFTFDLAYSSVLKR
AIRTMWITLDEMDLMWIPVVCDWHLNERHYGALQGMNKAETASKYGADQVLQWRRSYDTP
PKLLAEDDPRTMYKDPRYATLKREEIPLGECLKDTLLRVEPYWNDTIVPSIRAGRQIIIS
AHGNSLRALIKILDDISDQDIVSLSIPNGRPIVYELDDNLKPIRHYYLGDQESLAAAVQA
AASHGPVP
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaatcgtattgatgcgccacggcgagtccacatggaacctcgataatcgcttt
accggctgggccgatgtcgatttgactgaaaaaggttgtgctgaagcaaagcacgccggc
aaattgctgcgcgatgcaggatttaccttcgacctggcttattcatccgtgctgaaacgc
gccatccgcaccatgtggatcacgctggacgaaatggatctgatgtggatacccgtcgtc
tgcgactggcacctgaacgaacgccattacggcgcgctgcagggcatgaacaaggctgaa
accgccagcaaatacggcgccgaccaagtcttgcaatggcgtcgtagctacgacacccct
cccaaactgctggctgaggacgatccgcgcaccatgtacaaggatccgcgctatgccacc
ctgaagcgtgaagaaattccgcttggcgaatgcctgaaagacacgctgctgcgtgtggaa
ccgtactggaacgacaccatcgtgccatccatacgggccggcaggcagatcatcatctcg
gcgcacggcaacagcctgcgcgccctgatcaagatactcgacgacatcagcgatcaggat
attgtttcgctgagcatcccgaacggccgccctatcgtgtatgaactggatgacaatctg
aaacccatccgtcattactacctgggtgatcaggaatcgctggcagcagccgtccaggcg
gccgccagccacggaccagtgccataa

DBGET integrated database retrieval system