KEGG   Herminiimonas arsenicoxydans: HEAR3147
Entry
HEAR3147          CDS       T00490                                 

Gene name
rplO
Definition
(GenBank) 50S ribosomal subunit protein L15
  KO
K02876  large subunit ribosomal protein L15
Organism
har  Herminiimonas arsenicoxydans
Pathway
har03010  Ribosome
Brite
KEGG Orthology (KO) [BR:har00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HEAR3147 (rplO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:har03011]
    HEAR3147 (rplO)
Ribosome [BR:har03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HEAR3147 (rplO)
  Bacteria
    HEAR3147 (rplO)
  Archaea
    HEAR3147 (rplO)
SSDB
Motif
Pfam: Ribosomal_L27A
Other DBs
NCBI-ProteinID: CAL63256
UniProt: A4G9R9
Position
complement(3109413..3109844)
AA seq 143 aa
MELNTIQPADGAKHYKRRVGRGIGSGLGKTAGRGHKGQKSRSGGFHKVGFEGGQMPLQRR
LPKRGFKSLATPYKAEVRLSDLEALPVTEIDILALKQAGVIGELARVVRVILSGELTKKV
TLKGLIATKGAKAAIEAAGGSVA
NT seq 432 nt   +upstreamnt  +downstreamnt
atggaattgaatactattcaaccagcagacggcgccaagcactacaagcgtcgcgtcggt
cgcggtatcggctccggtctgggcaagacagccggccgtggtcacaaaggtcaaaaatcc
cgttcaggcggtttccataaagtcggtttcgaaggcggtcaaatgcctttgcaacgtcgt
ttgcctaagcgtggtttcaaatcgctggcaacgccatacaaagcagaagttcgcttgtcc
gatctggaagcattgccagtaacggaaatcgatatcctggctttgaaacaagctggcgtt
atcggtgaactggcacgtgtcgttcgcgtgatcctgtccggtgagctcactaaaaaagtg
acactcaaaggcctgatcgcgacaaaaggcgcaaaagcagcgatcgaagccgctggtggt
tcggttgcttaa

DBGET integrated database retrieval system