KEGG   Haloarculaceae archaeon HArcel1: HARCEL1_04310Help
Entry
HARCEL1_04310     CDS       T05406                                 

Gene name
tenA
Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
harc  Haloarculaceae archaeon HArcel1
Pathway
harc00730  Thiamine metabolism
harc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:harc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HARCEL1_04310 (tenA)
Enzymes [BR:harc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     HARCEL1_04310 (tenA)
Transcription factors [BR:harc03000]
 Prokaryotic type
  Other transcription factors
   Others
    HARCEL1_04310 (tenA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AWB26989
UniProt: A0A2R4WZN3
Position
900032..900697
Genome map
AA seq 221 aa AA seqDB search
MSGTDDLLEIGEPIVDAIVDHPMVARLGDGTLDTAPFEYWVRQDYVYLIEYSRVFAHGAA
RAPDLQRMGRFAGLLDATLNTEMDLHRAYAAEFGISEAELEATEPSPTTQAYTDFLVRTA
AARPFGETVAALLPCMWGFNETAERLAADGLPEDERYAEWIETYSGEEFAELTEWCLDLT
DEVWAAATESERERYRDRFETSMRYEYRFWDAAWREEEWSV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaccgatgaccttctcgaaatcggggagccgatcgtcgacgcgatcgtcgac
catccgatggtcgcccgactgggggatggcacgctcgacaccgcgccgttcgagtactgg
gtgcgccaggactacgtctacctgatcgagtactcgcgcgtgttcgcccacggcgcggcg
cgagcgccggacctccagcgcatgggccggttcgcgggactgctggacgcgacgctcaac
accgagatggatctccaccgggcctacgccgcggagttcgggattagcgaggccgagctc
gaagcgaccgagccgtcgccgaccacgcaggcgtacaccgacttcctcgtccggacggcc
gcggcgcggccctttggcgagaccgtcgccgccctgttgccctgcatgtgggggttcaac
gagaccgccgagcgcctggccgccgacggcctgccagaggacgaacggtacgccgagtgg
atcgagacctacagcggcgaggagttcgccgagttgaccgagtggtgtctcgacttgacc
gacgaggtctgggccgcggcgacagagagcgagcgcgagcggtatcgcgaccgcttcgag
acctcgatgcgctacgagtatcggttctgggacgcggcctggcgcgaagaggagtggtcg
gtgtga

DBGET integrated database retrieval system