KEGG   Haloarculaceae archaeon HArcel1: HARCEL1_07355Help
Entry
HARCEL1_07355     CDS       T05406                                 

Definition
(GenBank) molybdopterin synthase
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
harc  Haloarculaceae archaeon HArcel1
Pathway
harc00790  Folate biosynthesis
harc01100  Metabolic pathways
harc04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:harc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HARCEL1_07355
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    HARCEL1_07355
Enzymes [BR:harc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     HARCEL1_07355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE MobB GTP_EFTU AAA_25 MMR_HSR1 PduV-EutP AAA_22 DUF3906 Roc
Motif
Other DBs
NCBI-ProteinID: AWB27537
UniProt: A0A2R4X165
Position
complement(1491214..1492035)
Genome map
AA seq 273 aa AA seqDB search
MKVIRVVGPSDAGKTTLIERLADCLADLGRVGTVKHIACEPTLDTDGTDTARHRTAGAAE
TYGLTDDGDWFATGEELSLTEALDRLAVDCRYALVEGYGTATLPTVALGDADAETVIAAG
ETADDVDLDAVIDATEAVDPYETLESLVARAKASPDADRAGAIATFTGRVRTLDDADDDP
TEWLEFERYETVADERMAAIREELTARDGVYEVFLHHETGVVDAGEDVVYVVVLADHRRE
AFETVEDGIDRLKDEVPLFKREVTVTDEFWAHE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcatccgtgtcgtcggcccgtcggacgcgggcaagacgacgctgatcgagcgt
ctggccgactgccttgccgacctgggccgggtcgggacggtgaaacacatcgcgtgtgaa
ccgactctcgacaccgacgggacagacacggcccgccaccggacggccggcgcggccgaa
acctacgggctgacggacgacggcgactggttcgccaccggcgaggaactgtcgctgacc
gaggcgctggatcgcctcgccgtcgactgtcggtacgcgctcgtcgaggggtacgggacg
gcgacactgccgacggtcgccctgggtgacgccgacgccgagaccgtgatcgccgcgggc
gagaccgccgacgacgtcgacctcgacgccgtgatcgacgccaccgaggcggtcgacccg
tacgagacactcgaatcgctggtcgcccgcgcgaaggcgtcgccggacgcggaccgggcg
ggcgcaatcgcgacgttcaccggccgagtccggacgctcgacgacgccgacgacgacccg
acggagtggctggagttcgagcgctacgagacggtcgctgacgagcgaatggccgcgatt
cgcgaggagttgaccgcccgcgacggcgtctacgaggtcttcctccaccacgagactggc
gtcgtcgacgccggagaggacgtcgtctacgtcgtcgtgttggccgaccaccgccgggaa
gcgttcgagaccgtcgaggacggcatcgaccgactgaaagacgaggtgccgctgttcaaa
cgggaagtcaccgtcaccgacgagttctgggcccacgagtag

DBGET integrated database retrieval system