KEGG   Halanaerobium hydrogeniformans: Halsa_0172
Entry
Halsa_0172        CDS       T01349                                 

Definition
(GenBank) Xylose isomerase domain-containing protein TIM barrel
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00525  Acarbose and validamycin biosynthesis
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    Halsa_0172
Enzymes [BR:has01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     Halsa_0172
SSDB
Motif
Pfam: AP_endonuc_2 ZnuA
Other DBs
NCBI-ProteinID: ADQ13661
UniProt: E4RNX1
Position
193625..194434
AA seq 269 aa
MDNKIGICHWSLPMEGPLGCRLAAIIGLDGIQLDIGHSSRGFMLSRDFVQDAYLALGAKY
GISFPSITIRELDEVAMTDPEGTESRELMNEALIKTIDAAEAMNIPIVMVPSFVESEITN
EEEFQEAVSYLQYGCDYAQGKRITIATENTLSVAEIKRLIKEVDRDNIKLYFDSQNHFLH
KDYNIAEILEELIDYVCQVHLKDGKDKDLSGALLGEGDTGFYETMEVLKKHNYSGWLVFE
NYYDRKPLSLENDNPVELIKKDLQTVKEV
NT seq 810 nt   +upstreamnt  +downstreamnt
atggataacaaaattggtatttgccattggtctttgccaatggaaggaccattgggctgc
agattagcagcaataataggtttagacggaatacagttagatatcggacacagttctcga
ggttttatgctttcccgtgattttgttcaggatgcttatctggctttaggtgcaaaatat
ggtatttcatttccttcaataacaattagagaattggatgaagttgcaatgacagatcca
gaaggaacagaatccagggaattgatgaatgaagccttaattaaaactattgatgcagca
gaagcgatgaacataccaatagtaatggtgccaagttttgtagaaagtgaaattaccaat
gaagaagaatttcaagaagctgtcagttatcttcagtatggttgtgattatgctcaggga
aaaagaataacaatagcaactgaaaacacactttctgttgcagagataaaaagattaatc
aaagaagttgatagagataatattaaattatatttcgattcccagaatcattttttgcat
aaagactataatattgcagaaattctagaagaattaattgattatgtttgtcaggtacat
cttaaagatggtaaggataaagatttaagtggtgccttattgggtgaaggtgatacaggc
ttttatgaaacgatggaagttcttaaaaaacataactattcaggttggttagtttttgaa
aattattatgaccgtaaacctctcagtcttgaaaatgataatcctgtagaacttattaaa
aaagatctacagacagtaaaagaggtttaa

DBGET integrated database retrieval system