KEGG   Halanaerobium hydrogeniformans: Halsa_0309Help
Entry
Halsa_0309        CDS       T01349                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00010  Glycolysis / Gluconeogenesis
has00030  Pentose phosphate pathway
has00051  Fructose and mannose metabolism
has00052  Galactose metabolism
has00680  Methane metabolism
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_0309
   00030 Pentose phosphate pathway
    Halsa_0309
   00051 Fructose and mannose metabolism
    Halsa_0309
   00052 Galactose metabolism
    Halsa_0309
  Energy metabolism
   00680 Methane metabolism
    Halsa_0309
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Halsa_0309
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Halsa_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Aldolase
Motif
Other DBs
NCBI-ProteinID: ADQ13785
UniProt: E4RPA0
Position
366376..367602
Genome map
AA seq 408 aa AA seqDB search
MKKRNCLLGQSGGPTAVINSSYRGILDQVKKSADLDRIYAMRFGLQGLLAGKYFDLTEKS
EKELELLQNTPSTVIGTSRYKIDHYDENEEDYIKFFNFLEEHQIAYVFYVGGNDSMDTVA
KLTSYAEEKGIDVRIMGIPKTIDNDIVITDHCPGFGSAAKYIATSVMEIARDSRVYDLKN
VHIIETMGRSSGWLAAASILAANEKLYAPDFIYLPEAVFSIDKFFADVEKKMKEQKAITV
VVSEGIKDKNGEYISAGKSTAHDQFGHKKLGGAAYTLKPIIKENLCNRVKAIKFDVMQRA
AAHCASGRDIVEAYQVGAEAVKAALAGETGKMTAIKRISNDPYQVEIIKVEAEKVANQVK
LVPDKWINEDHNGVTEGFKDYVLPLIQGDIDMETENSLPVFSELETGQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaaattgtttgcttggacaatcaggtggacctacagcagtaattaattcc
agttatagaggtattctcgaccaggtaaaaaaatcagcagatttagataggatttatgcg
atgaggttcggtttgcagggtcttctagcagggaaatattttgatcttacagaaaaaagt
gaaaaggaattagaattattacagaacaccccatctaccgtaatcggtacttccaggtat
aagatcgatcattatgatgaaaatgaagaggattatattaagttttttaactttttagaa
gagcatcaaatagcttatgtgttttatgttggtggtaatgattcgatggatactgtagca
aagttgaccagttatgctgaagaaaaaggaattgatgttaggataatgggtatccccaaa
acaattgataatgatatagtaataacagaccactgtcctggctttggtagtgcagccaaa
tatattgcaacttccgttatggaaattgccagagacagcagggtctatgatcttaaaaac
gttcatatcatcgaaacaatgggccgcagtagtggctggctggcagctgcaagtatttta
gcagccaacgaaaaattatatgctccagattttatctatctacctgaggcagtatttagc
atcgataagttctttgcagatgttgaaaagaaaatgaaagaacagaaggcgataacagtc
gttgtatcagagggtatcaaagataaaaatggagaatatatttcggcaggtaaaagtacc
gcccatgatcagtttgggcataaaaaacttggtggagcagcttatactttaaaacctatt
ataaaagagaatctctgtaatcgggttaaggcaatcaagtttgatgttatgcagagggca
gcagcccactgtgcttctggtagagatatagtggaagcctatcaggttggtgcagaagct
gtaaaagctgctctggctggtgaaaccggtaaaatgacagcaattaaaagaatctccaat
gatccctaccaggtagagataataaaagttgaggctgagaaagtagccaatcaggtaaaa
ttagtgcctgataaatggattaatgaagatcataatggggtaacagaaggatttaaagat
tatgttttacccttaattcaaggtgatatagatatggagacagagaactcattacctgta
ttttcagaactggaaactgggcaataa

DBGET integrated database retrieval system