KEGG   Halanaerobium hydrogeniformans: Halsa_0391Help
Entry
Halsa_0391        CDS       T01349                                 

Definition
(GenBank) Sua5/YciO/YrdC/YwlC family protein
  KO
K07566  L-threonylcarbamoyladenylate synthase [EC:2.7.7.87]
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:has03009]
    Halsa_0391
   03016 Transfer RNA biogenesis [BR:has03016]
    Halsa_0391
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.87  L-threonylcarbamoyladenylate synthase
     Halsa_0391
Ribosome biogenesis [BR:has03009]
 Prokaryotic Type
  Other maturation factors
   Halsa_0391
Transfer RNA biogenesis [BR:has03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Halsa_0391
 Prokaryotic Type
    Halsa_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC SUA5
Motif
Other DBs
NCBI-ProteinID: ADQ13866
UniProt: E4RP41
Position
452987..454039
Genome map
AA seq 350 aa AA seqDB search
MNYQTEIIKANNDDQAVEKAAELLHKGELVAIPTETVYGLAADALNPEAVKRIFEAKGRP
QDNPLIIHIGAQKDLEKLIAEKVSKRAQKLIDKYWPGPLTLIFKKSSLVPAETSAGLDTV
AVRMPSHPVTIKLLQKSGLVLAAPSANTSGYPSPTRAEHVYADLKTKIPLILDGGSCEVG
VESTVIDLSQKEAVVLRPGGISREELAEFLGEELKLNNNLEKSTQGVISPGMKYRHYAPQ
KNLYIFDPVKKDLLFKKAEQKKIALIISRQTELGQKEDQLKVIRAFDREKPAELARKLFA
LLRELDSDPEVEEIYIEELKEEGLGETLMNRIYKAAAAKDEAQPGGGDNS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcaaacagaaataattaaagccaataatgatgatcaggcagtagaaaaagct
gctgaacttctgcataaaggagaactggtagctataccaaccgaaacggtttatggtctg
gctgctgatgctttaaaccccgaagctgttaaaaggatctttgaggctaagggtagaccc
caggacaatcctctgataattcatatcggagctcaaaaggatttagaaaaattaatagca
gaaaaggtttccaaaagagctcaaaagcttatcgataaatactggcccgggccattaacc
ctgatttttaaaaaaagttctctggttccagctgagacttcagccggtctggatacagta
gcagttagaatgccttctcatcctgtaaccattaagcttttgcaaaaaagtggtctggtc
ttagcggctccaagtgcaaatacttcaggttatccaagtccaaccagggcagaacatgtt
tatgctgatcttaaaacaaaaatccctctaattttagatggaggcagttgtgaggtaggg
gttgaatcaacggtaatcgacctcagtcaaaaagaagcagttgttttaagacctggaggt
atcagccgggaagagctggccgaatttttaggtgaagaacttaaattaaacaataattta
gaaaaaagtactcaaggagtgatttcaccggggatgaaatacaggcattatgccccccaa
aagaatttatatatttttgatccagtaaaaaaagacttgctttttaaaaaggctgagcaa
aaaaaaattgctctgataatttctcggcaaacagagctgggccagaaagaagatcagctc
aaggtcatcagagcctttgatagagaaaagccggccgagctggcccgaaaactatttgct
cttttgagagagctggacagtgatcccgaggtagaagaaatatatattgaagaacttaaa
gaggaaggtttaggagaaactttgatgaacaggatttataaggcggcagcagcaaaagat
gaagctcaaccaggaggtggagacaattcatag

DBGET integrated database retrieval system