KEGG   Halanaerobium hydrogeniformans: Halsa_0393Help
Entry
Halsa_0393        CDS       T01349                                 

Definition
(GenBank) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00240  Pyrimidine metabolism
has01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Halsa_0393
Enzymes [BR:has01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     Halsa_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPRTase Pribosyltran PRTase_2
Motif
Other DBs
NCBI-ProteinID: ADQ13868
UniProt: E4RP43
Position
454633..455262
Genome map
AA seq 209 aa AA seqDB search
MSKVHVMDHPLITHKISIIRDKNTGPKEFRELVNEIATLMAYEVTRDLPLKEVEIETPLR
KDRFKMISGKKIGIVPILRAGLGMLDGILKLMPAARVGHIGLYRDPDTLEAIEYYCKLPT
DVEERELLVIDPMLATGNTALEAIKFIKARNPKNIKLMVLIAAPEGVEKIQRAHPDIDIW
VGALDEKLNDHAYIVPGLGDAGDRLYGTK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaaagtacatgtaatggatcatccgctaatcacacacaaaatatcaattatcagg
gataaaaatacaggtcctaaagaatttagagaactggttaatgagatcgccaccctgatg
gcttatgaggtaacaagggatcttcccttaaaagaggtggaaatagaaaccccacttaga
aaagacaggtttaaaatgatttccggcaaaaaaatcgggatagtaccgatcttacgagca
ggcttggggatgttagatgggatacttaaattaatgcctgcagccagggttggccatatt
ggtctttacagagatcctgatacattagaagctatagaatattattgtaaattgccgaca
gatgttgaagaaagagagctgctcgttattgatccgatgctggccaccggtaataccgct
ctagaagcaattaaatttatcaaggctagaaaccccaaaaacattaaattaatggtttta
atagctgctccagaaggagtagagaaaattcaacgcgctcatcctgatattgatatctgg
gtaggagctcttgatgagaagttaaatgaccatgcttatatagttcctggacttggtgat
gctggtgacagactttatggaactaagtaa

DBGET integrated database retrieval system