KEGG   Halanaerobium hydrogeniformans: Halsa_0395Help
Entry
Halsa_0395        CDS       T01349                                 

Definition
(GenBank) hypothetical protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATPase_gene1
Motif
Other DBs
NCBI-ProteinID: ADQ13870
UniProt: E4RP45
Position
456459..456680
Genome map
AA seq 73 aa AA seqDB search
MDNKNWNQILRALSLLSQVGLIIIISGGIGFAFGYFIDYLLNFELLFKLTGLLVGLGAGF
YTVYKLLISTFDD
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atggataataaaaattggaatcaaattttaagagctctatcacttttaagccaggtaggt
ctgattatcataatatctggtgggattggttttgcttttggttattttatcgattacctt
ttaaattttgaattattatttaaattaactggacttctagttggtttaggagccggtttt
tatactgtatataaactgcttatttcaacatttgatgattaa

DBGET integrated database retrieval system