KEGG   Halanaerobium hydrogeniformans: Halsa_0396Help
Entry
Halsa_0396        CDS       T01349                                 

Definition
(GenBank) ATP synthase F0, A subunit
  KO
K02108  F-type H+-transporting ATPase subunit a
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00190  Oxidative phosphorylation
has01100  Metabolic pathways
Module
has_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Halsa_0396
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:has00194]
    Halsa_0396
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:has03110]
    Halsa_0396
Photosynthesis proteins [BR:has00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Halsa_0396
Chaperones and folding catalysts [BR:has03110]
 Other chaperones and cochaperones
  PapD
   Halsa_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_A
Motif
Other DBs
NCBI-ProteinID: ADQ13871
UniProt: E4RP46
Position
456723..457382
Genome map
AA seq 219 aa AA seqDB search
MSPGPAVQFYIFGNQNLPVTDTLLVGWLTMIIIIIGAKYLTSKLEIRPNKKQNVAEFLIE
AIHGQIEPMLPGEGWKFMPFIATIFIYITLSNIILVIPGLTSPSADLNLTLGLALVVFIV
VQQQGIKEYGFLGYLKSYAEPVIFLLPINVIGELAKPISHSFRLFGNIIGGLIIVTLIYQ
AAPPIIPIPLHLWFDLFVGLIQGFIYGMVAIAYISVAKT
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgagtccaggtccagcggtacaattttatatatttggcaatcaaaaccttcctgtaact
gatactcttttagttggttggttaacgatgataattattataattggagctaaatacctc
acctctaagttggaaatcagaccgaataaaaaacaaaatgtggctgaatttttgattgaa
gctattcacggtcagattgaaccaatgttgcctggagaaggatggaagtttatgcccttt
atcgccacgatatttatctacattaccctcagtaatattatacttgtaatccctggctta
acaagcccttcagcagatttaaatttaactttaggtctagctttagtggtctttatagta
gttcagcagcagggaatcaaagaatatgggtttttgggttatctaaaaagttatgctgag
ccggtaatctttttgctgcctataaatgtaattggtgaactggcaaaacctatttctcat
tcttttcgtctatttggtaatattataggtggtttgattattgtgactttgatttatcag
gctgcaccaccgattattccgattccactgcatttgtggtttgatttatttgttggttta
attcagggctttatctatggtatggttgccatagcatatatctcagtggccaaaacataa

DBGET integrated database retrieval system