KEGG   Halanaerobium hydrogeniformans: Halsa_0405Help
Entry
Halsa_0405        CDS       T01349                                 

Definition
(GenBank) ATP synthase F1, epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00190  Oxidative phosphorylation
has01100  Metabolic pathways
Module
has_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Halsa_0405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:has00194]
    Halsa_0405
Photosynthesis proteins [BR:has00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Halsa_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE MtrG
Motif
Other DBs
NCBI-ProteinID: ADQ13880
UniProt: E4RP55
Position
463719..464150
Genome map
AA seq 143 aa AA seqDB search
MAEAPKIQLDVVTPQKLIFSGKIDKLEGPAIDGLIGILPRHAPLVTAMKIGVVRISKDEE
ETQIAISDGFMEVQPDQINLVVRTAETPDQIDVERAKRAKERAEEKLEKDEEKIDFARAE
AAYERAVARLKAAGHHDHGYSGI
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcctaaaattcaacttgatgtagttacaccacagaaactgatcttcagt
ggtaagatcgataagctagagggtccagcgatcgatggtttaatcggtattttaccaaga
catgcacctttagtaactgcaatgaaaattggagttgttagaatctctaaagatgaagaa
gaaacccagattgcaatcagtgatgggtttatggaagtacagccagatcagatcaacctg
gttgttagaaccgccgaaactcccgatcagatcgatgttgaaagggcaaaaagagctaaa
gaaagggcagaagaaaaactggaaaaagatgaagaaaaaatagattttgccagagctgaa
gcagcctatgaaagagctgttgccagattaaaggctgccggtcatcatgaccatggctat
tcaggcatttaa

DBGET integrated database retrieval system