KEGG   Halanaerobium hydrogeniformans: Halsa_0411Help
Entry
Halsa_0411        CDS       T01349                                 

Definition
(GenBank) cell shape determining protein, MreB/Mrl family
  KO
K03569  rod shape-determining protein MreB and related proteins
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:has03036]
    Halsa_0411
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:has04812]
    Halsa_0411
   02048 Prokaryotic defense system [BR:has02048]
    Halsa_0411
Chromosome and associated proteins [BR:has03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Halsa_0411
Cytoskeleton proteins [BR:has04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actins
    Halsa_0411
Prokaryotic defense system [BR:has02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Halsa_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreB_Mbl FtsA HSP70 Actin EutA PilM_2 StbA
Motif
Other DBs
NCBI-ProteinID: ADQ13886
UniProt: E4RP61
Position
469142..470182
Genome map
AA seq 346 aa AA seqDB search
MFTKLLNKFSKKIAIDLGTATVIIYEQNKGIVLQEPSFVAINTNSNSVIAVGEEARRMLG
RTPDHIKVVRPLKDGVIANFEVAELMLKSFLKKVGVKSRFIKPLIMVCIPVGVTGVESRA
VLEAALQVGARQAFLIEEPIAAAIGSGLQIEKAEGNMIIDIGGGTTEIAVLSLGGIVTGE
SIRVGGDKFNEALVRFVREHYNLVIGESTAEEIKINIGTANPELELSYEVKGRDLMTGLP
RHIEITSAETQKAFKELLDNIAHAARRVLEKTPPELSGDIVEKGIILTGGGALLKGIDKF
ISANTEVSAFVTDDPLICVAEGTGHALSELDNISNVLSTGEKGSSS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaaaacttttgaataaatttagcaaaaaaattgcgatcgatctcggaacagct
acagtaattatatatgaacaaaacaaaggaatagtacttcaggaaccttcttttgttgct
attaacactaatagtaatagtgttattgcagtaggagaagaagcaagaagaatgttagga
agaacaccagatcatattaaagtggttagaccattaaaagatggtgttatagcaaatttt
gaagtggcagaattaatgttgaaaagttttttgaaaaaagtcggggtaaaaagccgtttt
ataaagccgctgatcatggtttgtatcccggttggtgttacaggagttgaaagtagggca
gtgctggaagctgcacttcaggttggggccagacaggcctttttgatcgaagagccaatt
gctgcagcaatcggatccgggctgcagatcgaaaaagcagaaggcaatatgataatcgat
attggaggaggaacaacagagattgcagttttatcactgggaggaatagttaccggagaa
tcgatcagggtaggtggagataaatttaatgaagctttagttcgttttgttagagaacac
tacaacctggtgatcggtgaatctaccgctgaggagataaagatcaatatcggaaccgca
aatccagagcttgaactaagttatgaagttaagggaagagatctgatgaccggtttacca
agacatatagagatcaccagtgcagaaacccagaaagcttttaaagaactgctcgataat
attgcccatgctgcaagaagggttttagagaaaacacccccggaactttctggtgatata
gttgaaaagggaataatattaacaggtgggggagcacttttaaaagggatagataaattt
atttcagctaacacagaagttagtgcttttgtaacagatgacccccttatctgtgttgca
gaaggaacaggccatgcattatcggaacttgataatatatccaatgttttaagtacggga
gagaaaggaagttcttcttaa

DBGET integrated database retrieval system