KEGG   Halanaerobium hydrogeniformans: Halsa_0413Help
Entry
Halsa_0413        CDS       T01349                                 

Definition
(GenBank) protein of unknown function DUF490
  KO
K09800  translocation and assembly module TamB
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:has02000]
    Halsa_0413
Transporters [BR:has02000]
 Other Transporters
  Pores ion channels [TC:1]
   Halsa_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TamB AsmA_2 AsmA AsmA_1
Motif
Other DBs
NCBI-ProteinID: ADQ13888
UniProt: E4RP63
Position
472226..476665
Genome map
AA seq 1479 aa AA seqDB search
MDKQIKYLIGVLIFLILAAYVLSLLSGLPRFFEDDIIALLEREIGGDIAFESISLWPLNR
INIEEFEYSDELGNSFRAEEFELDYSFNFRADNGFIGIEFIGLKNAVIEIEELDIELPGA
GPDLEETTEEELEKELADRAAELELPAFLANFDLNIEDSVLYSRLEDYSFRLDSLNLGLR
ARSVKDFDFNFSSEVEISQILLPDGQYLSDFNLDKLELNLKQSEQQTDLYLNTSKIDLAS
LGQLLEVESYNLAEFTLDLDEIEGLAAFKGQINFGEGKIESYQAEIGLENIKLPANYQFE
NEAGQQREEFEFSLAEGDLLIDGPELRAAFAKSLIDIDNNIIELAFKYSVDGDFEIQAAA
DALRLDYEFLEEYLSSGIFDFKLFAEGEDDNFKKGSLELSAQNLSTALDFEIEQSSFELR
LLDEDIFLDRGELNFADGGELNLKGNYNYQNNNYLLNAEATELKLNQQLQNLIEEFELDN
PTLDLLLANEAKELDFLIDTAGIYTGDRDLSSTGELSLDLRLSEDREFSFLSSFWYYEEI
LNLSSFKMESDHGRLDLSGEINFADQSLDLSYAGRDIDPTLIASLNGFEEEFLADLNTVF
DHLEGSVSSSFNNPRATLTAEMSHLSYQNYNLENLTLRAVYEEHNLDLQRFSADLNQGEL
LGSGRIDNLNRPSEAELALNFNTDNFYYNDISEIINRELPLNGAVNIEVALGGTLFDPDI
NLHLEADNTIFLSAGQEFEFSTLNARLSRENSRFELEELRAVHQDLEFNAAGSYDQQDGF
EIDYQLQNFELSQYLGEFIPRSDTLSGIVDLEGELRGDIFAPQLDFNIISNSLSYQNLEI
EFLENSFSYLVLEDRLILEQFDFMVDQGSYDLSGELSELRTVQRADLELAIKEVPLKNTV
EKFANFYPLAEDMILNGRAEISGEGRDVAAQLDISGNFMEHQNSSFEISGKAGRELDIDF
SSSDIPIDFVYRQFDYNLSLISNFACEGSISGSIDAPLLELEHSLTEITLNEIAIESLEG
EFTFEDGNFISVQERIEFQQGGNLELEGSYSILEDQLDLDSEINSLPIAFLLSFFSEDMT
ADGQIDGNVSVTGSIEEAILGGELRIAGRSLELGLSHPIRDFKGVIELSRSNIIVQRLDG
LFADGNFDVSGNIDLFAEENAWNLDLKGERLYFLRGSVDGEFNLDGKFTGALLDPVLTGD
LEAYNMKIGIPFEWPEPQFDEDDFVPRVDIDIVPLDEVRVRNPNMNVLVESGSLNINFDN
TREDVLEMEGRLRSNQGVFNYYNSRFTLVNGQAIFTPVDEDNIPSLRVNAVTYAGGREIN
INLTGPADDMRITLTSTPEMTEEEILHLLTTRGALGTAILGDEEVGIESIILQELTRLLN
VFFQEDVISKIESGFQRALDLDRLEIDAFQYGLEREFAIYLGKDLSDKLYLEYASFFAEG
EEREGELSFQYRLTDITSLKGSYFGDDEYQISIETEFGF
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atggataagcaaattaaatatctaattggtgttctgatattcttgattcttgctgcttat
gtactaagcttattatcaggccttccaagattttttgaagatgacattattgccctgctg
gaaagagaaatcgggggcgatattgcctttgaatccatttcactatggcctctcaacaga
ataaatattgaagaatttgagtacagtgatgaacttggtaattcctttagggccgaagag
tttgagcttgattatagttttaacttcagggctgataatggttttatcgggatagaattt
atcggcttaaaaaatgctgttatagagatcgaagaacttgatattgagctgcccggtgct
ggcccggatcttgaggaaacaaccgaagaagaactggaaaaagagttggcagatagggca
gcagaactagagttgccggcatttttggccaattttgatctaaatatagaagattcagtg
ctgtattcacgtctggaagattatagttttagattagattctttaaatttaggtttaaga
gcaaggtctgttaaagattttgattttaacttcagttctgaagttgagatatcccaaatt
ctactacctgatggtcagtatttaagtgatttcaatttagataaattggagctcaactta
aagcaatcagagcagcagacagatttatatttaaatacttctaaaatagatttagctagt
ttgggacagctgcttgaggtagaaagctataatttagctgagttcacacttgatctggat
gaaattgagggtctggcagcttttaaagggcagatcaattttggtgaaggtaaaatcgaa
agttatcaggcagaaatcgggctggagaatattaagctaccagctaattatcaatttgaa
aacgaagcaggtcaacagcgagaagagtttgagttcagtctggctgaaggagatttgttg
atagatggccccgaattgagggctgcctttgctaagagtttgatcgatatcgataacaat
attatagagcttgcatttaaatacagtgtagatggtgattttgaaattcaagctgcagct
gatgccttaagacttgactatgaatttttagaagaatatctcagctcaggaatcttcgat
ttcaaactatttgctgaaggtgaggatgataactttaaaaagggtagtctggaacttagt
gctcaaaatctgtcaacagcacttgattttgaaatcgagcagagcagctttgagttgaga
cttttagatgaagatatttttcttgatagaggagaattaaatttcgctgatggtggagag
cttaatctgaaaggaaactataattatcagaacaataactatcttttaaatgcagaagct
accgaacttaaattaaatcaacagctgcagaacttaattgaagagtttgaattagataat
cctactttagatctactgctggcaaatgaagctaaagagcttgattttttaatagatact
gccggtatttatacaggggatagagacctttcatctaccggagagttaagccttgacctc
agattgtctgaagacagagagttttcttttctttcttctttctggtattatgaagaaatt
ttaaatttaagcagctttaaaatggaatcagaccatggcaggttagatttaagtggagaa
atcaattttgccgatcagagccttgatttaagttatgctggccgggatattgatccaact
ttgatcgccagtttaaatggttttgaagaagaatttttagcagatttgaatacagtgttt
gaccatcttgagggttctgttagcagcagttttaataatccaagggctactttaaccgct
gagatgtctcatctcagttatcagaattataatttagaaaatttaactttaagagctgtt
tatgaagagcacaatctggatctgcagagattttcagctgatttaaatcagggagaacta
ctgggttcaggtagaattgataacctgaatcggccttcagaagcagagcttgctttaaac
tttaacacagataatttttattataatgatatttctgagataattaatagagaactaccc
ttaaatggagctgtaaacatcgaagttgctctaggtggtaccctctttgatccagatatt
aatcttcatctggaagcagataatactatatttctttctgcaggccaggaatttgaattt
tcaactttaaatgccagactgtctagagaaaattctcgttttgaactggaagaattacga
gcggttcaccaggatctggagttcaatgctgctggcagctatgatcagcaggatggtttt
gaaatcgactatcagcttcaaaactttgagcttagtcagtacttaggggagtttattcct
cgttctgatactttaagtgggattgtagatcttgaaggagaattaaggggcgatatcttc
gcacctcaattagattttaatattatctctaattctttaagttatcaaaatttagagata
gaatttttagaaaacagctttagctacctggttttagaagatcgtttaatccttgagcaa
tttgatttcatggttgatcagggtagctatgatctcagtggagaactgtcagagcttaga
actgtacagcgagctgatttagaattagcaattaaagaggttccgctaaaaaatactgta
gaaaaatttgctaatttttacccattagcagaagatatgatcctaaatggtcgggctgaa
ataagtggagaaggaagagatgttgcagctcaacttgatatcagtgggaactttatggaa
catcagaattctagttttgaaatcagtggtaaagcaggtagagaattagatatagatttt
agttcatctgatatcccgatagattttgtctacaggcagttcgattacaatttgagtttg
atcagtaattttgcctgtgagggtagtatcagcggtagtatagatgctccactgcttgag
cttgaacacagtttaacagagatcacccttaatgagatcgcaatagaatctttagaaggt
gaatttacctttgaagacggtaactttatttctgttcaggaaagaatagagtttcaacag
ggtggtaatcttgaacttgaaggcagttattcgattttagaagatcagcttgatcttgat
tctgagatcaattcactacctatagcctttttgctgtcctttttctctgaagatatgaca
gctgatgggcagatagatggtaatgttagtgttactggtagtatagaagaagctatttta
ggtggagaactaaggatcgccggtcgttcactagagctcggcttatcccatccgatcaga
gattttaagggggtaatcgaactaagccgttctaatattattgtacagagactggatggt
ttgtttgcagatggtaattttgatgtcagtggaaatatagatctttttgctgaagaaaat
gcctggaacctggatttaaaaggagaaagactctactttttaaggggttctgttgatgga
gagttcaatctcgatggtaaatttactggggccctgcttgatccggttttaacaggtgac
ttagaagcctataatatgaaaattggtataccatttgaatggcctgaaccacagtttgat
gaagatgattttgtgcctagagttgatatagatatagtacctttagatgaagtaagggtt
cgtaaccctaatatgaatgttctcgttgaaagtggcagtttaaatattaattttgacaat
acaagagaagatgtgctggaaatggaaggccgcttacgcagtaaccagggggtatttaat
tattataattctcgttttaccctggttaatggtcaggccatctttaccccggttgatgag
gataatataccatctctaagagttaatgcggttacctatgccggtggtagggagataaat
atcaatttaacaggaccggcagatgatatgcggataaccctgacttctactcctgagatg
actgaagaagaaatacttcacctgctgacaacaagaggtgctttgggtacagcgatttta
ggtgatgaagaagtagggatagaaagtatcattttgcaggaactgaccagattattaaat
gtttttttccaggaagatgtgatcagtaaaatagaaagtggttttcagagggcattagac
ctcgacagattagagattgatgcttttcagtatggattagaaagagaatttgcaatttat
cttggtaaagatcttagtgataagctttatctagaatatgcaagcttttttgctgagggt
gaagagagagaaggagaactttccttccagtatcgtttaacagatataacatctcttaaa
ggaagctattttggagatgatgaatatcaaattagtatagaaacagagtttggattttaa

DBGET integrated database retrieval system