KEGG   Halanaerobium hydrogeniformans: Halsa_0415Help
Entry
Halsa_0415        CDS       T01349                                 

Definition
(GenBank) outer membrane chaperone Skp (OmpH)
  KO
K06142  outer membrane protein
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Halsa_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpH ABC2_membrane_3 GrpE DUF4469
Motif
Other DBs
NCBI-ProteinID: ADQ13890
UniProt: E4RP65
Position
478476..478931
Genome map
AA seq 151 aa AA seqDB search
MMNWKNSKFQIAVLLLLLAILAALLALGIFSDDQSVDSVAYVNLERIFEKHPARLAAENT
LNQKAAEYQQEIETQYADAGGSEQKEIIRKHQAQLQELEAELLDGVIAELLTVIEETAAE
KNVKFVLEEEYILYGGYNLTESVLEKIEAKW
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattggaaaaatagcaaatttcaaatagcagttcttttgctgttattggccatc
ctggcagctcttttagcgctgggcatcttcagtgatgatcaaagtgttgatagtgtagcc
tatgttaacctggaacggatatttgaaaaacatccggccaggctggcagcagaaaatacc
ttaaatcaaaaagccgctgaataccagcaggagatcgaaactcaatatgctgatgccggt
ggtagtgagcaaaaagagattattagaaaacaccaggcacagcttcaggagctggaagca
gaacttttagatggagtaattgctgaattattgacggtaatagaagaaaccgcagcagaa
aagaatgttaaatttgttctggaagaagaatatatactctatggaggctataatttaacc
gaaagtgttttagagaaaatagaggctaagtggtaa

DBGET integrated database retrieval system