KEGG   Halanaerobium hydrogeniformans: Halsa_0425Help
Entry
Halsa_0425        CDS       T01349                                 

Definition
(GenBank) protein of unknown function DUF1239
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptC OstA
Motif
Other DBs
NCBI-ProteinID: ADQ13899
UniProt: E4RP74
Position
486798..487376
Genome map
AA seq 192 aa AA seqDB search
MDKKHIFLGLFIFMIIVISLFLTLDDPPFIEPNDLNEVEEGAEEELEDVRFSIINRNQNH
ELKLISERVDNYQSENRMELYPVEIEVYDREDGELLYTLKGDFGQYFTREDYIELRGNVE
IESDRYFIEADELDYFLNEDFLEGRDSVQIRGADFTSTAKRFDSDLNLRNLRLYAEENQT
RAGVYFEEQNDE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaacatatttttctggggctctttatttttatgataatagtaatttctctc
tttttaacccttgatgatcccccttttatagaaccgaatgatctaaatgaggtcgaagag
ggggcagaagaagaattagaagatgtcaggttcagcatcatcaacagaaatcaaaaccat
gaactgaagttgatcagtgagcgggtagataactaccagtctgaaaataggatggagcta
tacccggttgaaatcgaggtctatgaccgtgaagatggagaattactctataccttaaag
ggagatttcggtcagtattttacccgggaagactatattgaactcaggggtaatgtggaa
atagaaagtgaccgctattttatcgaggctgatgaacttgactactttttaaatgaagat
tttttagagggaagagattctgtgcagatcagaggggctgatttcacttctacagctaaa
agatttgattctgatttaaatttaaggaatttaagactctatgccgaagaaaatcaaaca
agggcaggagtatattttgaggagcagaatgatgaataa

DBGET integrated database retrieval system