KEGG   Halanaerobium hydrogeniformans: Halsa_0428Help
Entry
Halsa_0428        CDS       T01349                                 

Definition
(GenBank) permease YjgP/YjgQ family protein
  KO
K11720  lipopolysaccharide export system permease protein
Organism
has  Halanaerobium hydrogeniformans
Pathway
has02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:has00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Halsa_0428
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:has02000]
    Halsa_0428
Transporters [BR:has02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00320]
    Halsa_0428
 Other Transporters
  Pores ion channels [TC:1]
   Halsa_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptF_LptG DUF1192
Motif
Other DBs
NCBI-ProteinID: ADQ13902
UniProt: E4RP77
Position
488720..489820
Genome map
AA seq 366 aa AA seqDB search
MKTVDKYIYKELIAPFLFGVAAFTGIFIGTDLIFEVTEYYIEWGVDVLTLLRLFFLSLPE
IIILTFPMAALLGTIMAYNRLSGDSEITAMRAGGISIMAIVLPALIMGLVTSGITIAITE
FIVPGANYQAEQIIHQFKHGERRPDTQYDLFLTPLDSRTSRPDYMLYAKSFNAENGRMTD
VVLQSFEDGRPRSVLEAEEALWLRDGWSFFNGTVYFLDREDRSPSLEFSQYRSREDIHSP
AQAGKLGKDIDEMNIRELNEHIALLEQQGRAAYEERVEFHHRFSVPMASFIFALLAAPLG
IKPQRSAGSATGFGISIIIIFIYYVLMTIGDALGSQGTIEPWLGAWLQNIIIFLVGSGLL
YKTAKQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacagttgataaatacatctacaaagaattgatagcaccttttttattcggggtg
gcagcttttaccggtatctttatcggtacagatctgatctttgaggtgacagaatattat
atagaatggggagtagatgttttaaccctgctcaggcttttctttttaagtttgccggag
ataattattttgaccttcccgatggcagcacttttaggaaccattatggcctataacagg
ctgtccggtgatagtgagataacagccatgcgggcgggaggaatcagtattatggctata
gtcttacctgccctgattatgggacttgtaacaagtgggattacaatcgctatcacagaa
tttattgtacctggtgcaaattatcaggcagaacagataatccatcaatttaaacacggg
gagcgaagaccggatacccagtatgacctctttttaacccctttagacagcaggacgagc
agacctgactatatgctttatgcaaaaagttttaatgccgaaaacggcaggatgacagat
gtggtattacagagctttgaagatggtagacccagaagcgtacttgaagcagaggaagcc
ctctggctgagagatggctggagcttttttaatggcacagtctattttctggacagagag
gaccgttcaccatctttagagttcagccagtaccgttctcgggaggatatccattctcca
gcccaggctggtaagcttggtaaggatatagatgagatgaatatcagagaattaaatgaa
cacatcgcacttttagaacagcagggcagggcagcatatgaagagcgggttgagttccac
caccgcttttcggttccgatggcaagctttatctttgccctcctggcagctccactgggg
atcaaaccacagcgttctgccggttcggcaacaggttttgggatcagtatcataatcatc
tttatctattatgtgctgatgaccatcggagatgctttaggcagtcagggtacgatagaa
ccatggcttggagcctggctgcagaatataataatctttttagttggttcaggactttta
tataaaacggcaaaacaataa

DBGET integrated database retrieval system