KEGG   Halanaerobium hydrogeniformans: Halsa_0437Help
Entry
Halsa_0437        CDS       T01349                                 

Definition
(GenBank) cation transporter
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkH DUF2976
Motif
Other DBs
NCBI-ProteinID: ADQ13911
UniProt: E4RP86
Position
499527..501023
Genome map
AA seq 498 aa AA seqDB search
MIKSSRVNAIFYYLSYLLFILAIILLFPLALAFIYREGNNLYQAYYYTIILSAFTAIILK
VLSDKDNKNINLTTAMQLCAISWIVISFFGAFPFIFALEKSLIDAVFESTAGFTSAGLTV
FIGLDFMPKSIIFWRSLMQFLGGLGILTFFLLISTRAGGESWHFFSAEGHKYNLSRPVPN
IYRTVKILWSIYIVFVIAQTIILNLLGLSFFDALNISFTTISTGGFTHYDQSIAHFAASG
YQYFRLIEYVIIFFMFLGGVNFLLHFRFFTKDFAEIKNNSEFQTLLKIIFYGTLFLFVTI
VLLNTAVDSSIEEIFRKSLFQITAIVTTTGFSTESINSSFFPVAARQLFLLLMLIGGSVG
STSGGIKIMRLNILRSLFKRDIKKIYYPRHAVLPVTVDKQILSKDEIYKLTGLVTFWLIL
IVIGGIITALFSDLNGLEAYSTMFSALGNIGPSFISTERMLSLSPVIKFTYIIGMLAGRL
EILPLIILFSRKAWKSQA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagtcaagccgagtgaatgcaatattttactatttaagttatctgctttttata
ttagcaattattttattatttcctcttgctttggcatttatttatagggagggtaataat
ctttatcaggcttattattatactattatattgtctgctttcactgccataattttaaag
gtattgagtgataaagataacaagaacataaatttaactacagccatgcagctttgtgca
attagctggattgtaatatctttttttggtgcttttcctttcatattcgctttagaaaaa
tcactgattgatgctgtttttgagtcaacagctggttttacatctgccggtttaacagtt
tttatcgggcttgattttatgccgaaatctattattttctggcggagtttaatgcagttt
ttgggagggcttggaatcttaactttctttttattaatttcaaccagggctggtggagaa
agctggcattttttcagtgctgaaggacataaatataatttatcaagaccggtgcccaat
atttaccgtacggttaaaattttatggtcaatctatattgtatttgttattgcacagact
ataattttaaatttattggggctttctttttttgatgctttaaatatcagctttaccacc
atttccaccggtggatttacacattatgaccagagtatagctcattttgctgctagtggc
tatcagtactttagattaatagaatatgttattatcttttttatgtttttaggtggggtt
aactttctgctgcattttcgcttttttactaaagattttgcagaaattaagaataactct
gaatttcaaaccctgctcaaaataatattctatggaacactttttctttttgtaacaatt
gtgcttttaaataccgcagtcgatagttccatagaggagatatttcgaaaaagtcttttt
cagattactgccatagttactaccactggtttcagtacagaaagtataaattcttcattt
ttcccggtggcagccagacagctatttttattattgatgcttatcggaggaagtgttggt
tctacctctggtggtataaaaattatgaggcttaatatcttaagaagcctatttaaaaga
gatattaaaaagatatattatcccagacatgctgttttaccggtaactgtagataaacaa
atattatctaaagatgaaatctataagttgaccggtcttgtgaccttctggttaattttg
atagtgatcggtgggattataactgcacttttttctgatttaaatggattagaagcttat
tctaccatgttttctgccctgggtaatatcgggccatcttttatttcaaccgaaagaatg
ctttctttatcaccggtaatcaagttcacctatattattggtatgctggccggtaggtta
gaaatattaccactgattattcttttttccagaaaagcctggaaatctcaggcttaa

DBGET integrated database retrieval system