KEGG   Halanaerobium hydrogeniformans: Halsa_0441Help
Entry
Halsa_0441        CDS       T01349                                 

Definition
(GenBank) hypothetical protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_5 N_methyl DUF4624 HUN
Motif
Other DBs
NCBI-ProteinID: ADQ13915
UniProt: E4RPN1
Position
507388..508212
Genome map
AA seq 274 aa AA seqDB search
MRKLNNTKGFTLIELIVVIAILGILAAIAVPRFSGVIKRAHISADQTKVRALNSVTSVAR
MALLSEDPFIDNNETDQQLIAFLQGRGYLDDGPIEPQTRDAEFKWSFDDEKWYLMIGDSL
THYLLTTDDYESSEDNVTTLFSLNNIEHIGKYIQIPEGIKAIHGGSDDAAFWQKGLESVI
LPDSLEEIRAHTFQGNNLKEILIPNNVQNIGNNSFYNNPITKVTISGDQVNIEDRAFGTG
WSEAKEQTDAFREAYSEGGAGTYEWTGDKWIKTR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcttaataacacaaaaggatttactctaatagaattaattgttgtaatagct
atacttggtatacttgcagctattgcagtacctaggttttctggtgttattaagcgtgcc
cacatttctgctgatcaaactaaggtaagggcattgaacagtgtgacttcggtagctaga
atggcactgctttcagaggacccctttattgataataatgaaacagatcagcaattaatt
gcttttttacaggggaggggctacttagatgatgggccgattgagcctcagactagagat
gcagaatttaaatggtcctttgatgatgagaagtggtatcttatgataggggattcttta
acacattatttgctcactacagatgactatgaatcttcagaggataatgttactactcta
ttttcattaaataatatagagcatatcggaaagtatattcagatcccagaaggaataaaa
gccattcacggtggaagtgatgacgcagctttttggcaaaaaggccttgaatctgttatt
ctacctgattcattggaagaaattcgcgcccatacatttcagggaaacaacttaaaagaa
attttgatacctaataatgtgcaaaacattggaaacaattccttttataataatccgata
acaaaagttactataagtggtgatcaggtgaatatagaagaccgagcttttggaacaggg
tggtcagaggcaaaagaacaaacagatgcttttagagaggcttattcagaaggtggtgct
ggtacttatgaatggaccggtgataagtggattaagactaggtaa

DBGET integrated database retrieval system