KEGG   Halanaerobium hydrogeniformans: Halsa_0449Help
Entry
Halsa_0449        CDS       T01349                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00010  Glycolysis / Gluconeogenesis
has00030  Pentose phosphate pathway
has00052  Galactose metabolism
has00230  Purine metabolism
has00500  Starch and sucrose metabolism
has00520  Amino sugar and nucleotide sugar metabolism
has00521  Streptomycin biosynthesis
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
Module
has_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_0449
   00030 Pentose phosphate pathway
    Halsa_0449
   00052 Galactose metabolism
    Halsa_0449
   00500 Starch and sucrose metabolism
    Halsa_0449
   00520 Amino sugar and nucleotide sugar metabolism
    Halsa_0449
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Halsa_0449
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halsa_0449
Enzymes [BR:has01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Halsa_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV BHD_3
Motif
Other DBs
NCBI-ProteinID: ADQ13922
UniProt: E4RPN8
Position
517193..518938
Genome map
AA seq 581 aa AA seqDB search
MNYMSRYRDWLMSDYFDEETKEELEAIKEDEAEIEDRFYKNLEFGTGGMRGIMGAGTNRI
NKYIVRKATQGLANYIINYSEDGQDKGIVIAYDSRHNSPEFSLEAALVLAANGIKTYLFD
GMRTTPELSFAVRELDAIGGIVITASHNPPEYNGYKLYWEDGGQVVPAQARDIIAEIEEI
DDFSIVNIIDEDEALDQDLLEYIGSEIDEKYQDTVVDLLIDTDLAEEKGKDLSIVYTPLH
GTGSTAVPQVLEKLGFTNLAVVEEQADGDSDFSTVKSPNPEERTAFELAFELGKEKNADL
VLATDPDCDRLAPAVKDGDGNYQTLNGNELGVLFADYLLKSISESGELPDNGVIIKSIVS
TDMVREIAADYDIEVLDVLTGFKFIGEKITEFEETGDKDFILGFEESLGYLVGKHARDKD
AVVAAALAAIMTLKYKEEDKTLLQRLAELREQYGYYLEDLESIRLEGKEGQEVIEKTIAS
LREKSPEKIAGRKVLLAKDYKESKVVYIEEEREEELKLPQSNVLQYLLEGDAKLTIRPSG
TEPKLKFYFAIKAADKEAAEAGIAEFKEKVMSEMDTVMKSV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
ttgaattatatgtccagatatcgagattggcttatgagtgattattttgatgaagaaaca
aaagaagaacttgaagccatcaaagaggatgaagcagagattgaggatcgattttataaa
aatcttgaatttggaaccggtggaatgagagggataatgggtgcaggcacaaataggatt
aacaaatatatcgttagaaaagctactcagggtttagctaattatataattaattacagt
gaagatggtcaggacaaagggatagtaatcgcctatgattccagacataattcaccagaa
ttttcacttgaggcagcacttgtacttgctgctaatgggataaaaacatatttgtttgat
gggatgagaacaacacctgaactttcttttgcggttagagaacttgatgctatcggagga
atagttataacagcaagccataatcctccagaatacaatggttacaagctttactgggaa
gatggtggtcaggttgtaccagctcaggcaagggatataattgccgaaatagaagagatc
gacgatttttctattgttaacataattgatgaagatgaagctcttgatcaggatttattg
gaatacatcggtagtgaaatagatgaaaaatatcaggatactgtggttgatcttttaatc
gatacagatctagctgaggaaaaaggcaaagatttatcaatagtctatactccactccat
ggaacaggcagcacagcagttcctcaggttttagaaaagctaggttttactaatctggct
gtggtagaagaacaggcagatggagattcagacttttcaacagtgaaaagtccaaatccg
gaagaaagaacagcctttgaactggcttttgagctgggcaaagaaaaaaatgccgattta
gttttagcaactgatcctgattgtgaccgtctggcacctgctgttaaagacggtgatggt
aactaccagactttaaatggaaatgaactcggggtattatttgccgactatttacttaaa
agtattagtgaaagtggagaactgccagataatggagttattatcaaatcgattgtttcc
acagatatggtaagagaaatcgctgcagattatgatatagaagtactagatgttttaaca
ggctttaaatttatcggggaaaagatcacagaatttgaagaaacaggagataaagacttt
attctcggctttgaagaaagtctcggctatttagttggtaaacatgctagagataaggat
gctgttgtcgcagccgctctggcagccataatgaccttaaagtacaaagaagaagataaa
acattactacagagactggctgaactgcgtgaacagtatggatattatttagaagatctg
gaatctatcaggttagaaggtaaagagggccaggaagttatagaaaaaacgattgcttct
ttaagagaaaagagtccggaaaaaattgccggtcgcaaagtgctgcttgctaaagattat
aaggagtctaaggtagtctatatagaagaagagcgggaagaagaattaaagcttcctcaa
tctaatgtactgcagtatctattagaaggtgatgctaaattaacgatcagaccttcaggt
acagaaccgaaacttaagttctactttgcaattaaagcagcagataaagaggctgctgag
gcaggcatagcagagtttaaagaaaaagttatgtcagaaatggatacggttatgaaaagt
gtttaa

DBGET integrated database retrieval system