KEGG   Halanaerobium hydrogeniformans: Halsa_0453Help
Entry
Halsa_0453        CDS       T01349                                 

Definition
(GenBank) Sporulation domain-containing protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAGPA SPOR SpoIID
Motif
Other DBs
NCBI-ProteinID: ADQ13926
UniProt: E4RPP2
Position
523839..525938
Genome map
AA seq 699 aa AA seqDB search
MQKLKNLKKIGKYLFLCLALLLLFSLQAEANFFENGLQHYINSNHWLSIPVFQPADRIEI
RAEKDTVLRASGQEEFELEKGRSYFITQAAQSKADGWAIQLYATAEEENALQMQEELAVQ
FAEEITIEKEDELYKVLIGNFAERAEVDEFREDLRAEGYEGWPRLIDSEAEQISSGELGF
YTALGERLMTASIFEIEGSFDARANKLEGKYSFSLLDDQVSIRRQTDLEGLTASLLQNFL
SADDPPEALKAQAVLYRTSLLYQIETQGTQMQGINNIVLREADPVFKEAAAATKDLVLIR
NDSFFYDADLSLREIRKPRAGIVPLADAAYNYQEIINYYYGRAEIANLNDLMDRESRFKT
NISYGLSFEEIREMSWEGPRFLTIMELNLNLDRMQLKPVLARDIVQGREDLSDLVGRYSA
LAGINGGFFDHTGRPLGLVYLDGQLASEPLHSRTALLIDESGKAMIEPVDWQGKVLIPEL
EAEISLDGVNRKAESGEAVIFNRYFGDRMPELEDDYYDIVVRSDKILGVENNSRSRTPIA
PNGYIIRVHRDKEAVLALIPELKDKEIDLEMKFQPDFELNNIRYGLGGGPQLLRDGEIEI
TGEAERFQSDILNYRAPRTALGITENQRLIMLTVDGRQQDTSIGMTLEELAEFLQELGVK
DAMNLDGGGSSRMVVRGFTMSRPSEQRLISNGIIIESTN
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctaaaaaaccttaaaaaaattggtaaatacctgtttctttgcttagcttta
ctcttgcttttcagtctgcaggcagaggcaaatttttttgaaaatggtctgcagcactat
attaatagtaatcactggctttccatacctgttttccagcctgcagatagaattgagatc
agggcagaaaaagatacagttttaagggcttccggacaggaagaatttgagctggaaaag
ggtagatcatatttcatcacccaggcagctcagagtaaagctgatggttgggccattcaa
ctttatgcgaccgcagaggaagaaaacgccctgcagatgcaggaagaacttgctgtacag
tttgccgaggagattactattgaaaaagaagatgaactttacaaggttttaatcggtaat
tttgccgaacgggctgaggtagatgagttcagggaagatttaagggccgaaggttatgaa
ggctggcccaggttgattgattcagaagcagagcagatcagcagtggagaactgggattt
tatacagccctgggagaaaggctgatgacagcctcaatttttgaaatagagggctctttt
gatgctagagccaataagcttgaaggcaaatattcttttagtcttttagatgatcaggtt
tctatccgccggcagacagatttagaaggcttaacagcttctctactgcagaattttctc
tcagctgatgatccaccagaagctttaaaggcccaggcagtcttatataggacttccctc
ttatatcagattgaaactcaaggcacccaaatgcaggggattaataatatcgttttaaga
gaagctgaccccgtatttaaagaggctgcagcagcaactaaagatcttgttttgatcaga
aatgatagctttttctatgatgcagatttaagcctgagggaaatcagaaaacctagagct
ggtatagtacctctggcagatgcagcttacaattatcaggagatcatcaactactattat
ggtcgggcagagatcgccaatttaaatgatttaatggacagggaaagcagattcaagacc
aatatcagctatggtttaagctttgaagaaatcagggagatgagctgggaaggcccccgg
tttttaaccattatggaattgaatcttaacctggatcggatgcagttaaaacccgttctg
gccagagatatagtacagggtagagaagatttaagcgatctggtaggaagatattctgct
ctggcaggtatcaatggtggcttttttgaccatacaggaagacctcttggtctggtatat
ttagatggtcaacttgccagtgagcctcttcacagtaggaccgctctcttgatagatgag
tctggaaaagcgatgatagaaccggtggactggcaggggaaagttcttataccggagctg
gaagcagagatcagcctggatggagttaacagaaaagctgaatcaggtgaggctgtaatt
tttaaccgctattttggtgatcgcatgcctgagttagaagacgattattatgacattgtg
gttcgttcagataaaatactgggggttgaaaataattctagaagcaggactcctattgca
ccaaacggatatattatcagggttcacagggataaagaagccgtgctggctttgattcct
gaactaaaggataaagagatcgacctggaaatgaaatttcagcctgattttgagctaaat
aatattcgctatggattaggaggaggaccccagctgctcagggatggtgaaatagaaatt
actggtgaagcagaaagattccagtctgatattttaaattacagggctcctagaacagcc
cttggtattacagaaaatcagcgtttaataatgctgacagttgatggtagacagcaggac
acgagtatcgggatgaccttagaagaactggcagaatttctacaggaacttggcgtcaaa
gatgccatgaacctggatggaggtggctcatctagaatggtcgtccgtggttttacgatg
agtcgtcccagtgaacagcgtttaataagcaatggaatcataattgaaagtacaaattaa

DBGET integrated database retrieval system