KEGG   Halanaerobium hydrogeniformans: Halsa_0457Help
Entry
Halsa_0457        CDS       T01349                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03091  RNA polymerase sporulation-specific sigma factor
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:has03021]
    Halsa_0457
Transcription machinery [BR:has03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Halsa_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 HTH_23 GerE Sigma70_r4 HTH_28 HTH_Tnp_ISL3 UPF0122 HTH_10 OmpH Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: ADQ13930
UniProt: E4RPP6
Position
528203..528829
Genome map
AA seq 208 aa AA seqDB search
MFKEKEEEEIIEMAQAGNDFAIEYLIDQNMDIVYAKARFFFIKGLDRDDVIQEGRVGLYK
AIRDYREGKGASFRGFSQLCVHRQLVSAIKKANRQKHMPLNTSASLDKSLDYGNETGRTF
NEILPDEGENLERKFICQETLTTIVKELSRDLTDLEWNVFMLYLDSRSYQEISDQLDINV
KTVDNALQRARKKIEDLREHYNLKGVVG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaagagaaggaagaagaagagattattgagatggcccaggctggcaatgacttt
gccattgagtatttaatagaccagaacatggatatcgtttatgcaaaagccaggttcttt
tttatcaaaggtttagacagagacgatgttattcaagagggaagagtgggtttatataag
gcaatccgtgattaccgggaaggaaaaggagcttcttttcgaggtttttcacagctatgt
gtacacaggcagctggtatcagctattaaaaaagctaatagacaaaaacatatgccttta
aatacctctgcttcacttgataaaagtcttgattatggtaatgaaacagggagaactttt
aatgaaattttgcctgatgagggagaaaatttagaaagaaaatttatctgtcaggaaacc
ctaaccacaatcgttaaggaactttccagggatcttacagatcttgaatggaatgtattc
atgctttatctggacagcaggtcttatcaggagatttcagatcaacttgatatcaatgtt
aaaaccgtggataatgctctgcagagggcaagaaagaaaattgaggatctgcgagaacat
tataatcttaaaggagtagtgggctaa

DBGET integrated database retrieval system